(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE352

ASFUM1_6.PE352       Location/Qualifiers
FT   CDS             join(1097361..1097450,1097644..1098030)
FT                   /codon_start=1
FT                   /gene_family="HOG000200905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265337"
FT                   /orf_name="AFUA_6G04705"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27235.1"
FT                   /db_xref="UniParc:UPI0000F51CD8"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA17"
FT                   /transl_table=1
FT                   /translation="MPTSSQKGDINPPEEVTSEAVRGFLTGAFRFGSVSILAHMILMLP
FT                   HPFKFSPPAATPSHPPASPSSSRPKTLRFSKDHLRSKFIYGPLSGFSEWLSPTARVYRG
FT                   LTPQFKVFLQIAAMTLGGCIWAERRVNEYIDFMRKVKRAERLQAQRVARFSESE"
     MPTSSQKGDI NPPEEVTSEA VRGFLTGAFR FGSVSILAHM ILMLPHPFKF SPPAATPSHP        60
     PASPSSSRPK TLRFSKDHLR SKFIYGPLSG FSEWLSPTAR VYRGLTPQFK VFLQIAAMTL       120
     GGCIWAERRV NEYIDFMRKV KRAERLQAQR VARFSESE                               158
//

If you have problems or comments...

PBIL Back to PBIL home page