(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE353

ASFUM1_6.PE353       Location/Qualifiers
FT   CDS             1100796..1104788
FT                   /codon_start=1
FT                   /gene_family="HOG000200894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265338"
FT                   /orf_name="AFUA_6G04710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85569.1"
FT                   /db_xref="HOGENOM:HBG056185"
FT                   /db_xref="HOGENOM:HBG328172"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="UniParc:UPI000051E5BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG9"
FT                   /transl_table=1
FT                   /translation="MADSLGKKERRKSLSVFSPSSTTSILSGSAISHDRSPSDDVNTLK
FT                   KKNRRNSGFFGVRNTSPARTPGNNAQHWPDTIESESTAACIASTPTIIVPETTTRSRRK
FT                   SLQKRRTSVFGSLRSLHSLDDDEKSLGRVKGSPVDDEDAFASRNGIGSAILHHGAIQTT
FT                   GGMWRKKSQYLVLTDTHLVRFKSQSKAAEMFSSIPASYTRSPAMNRQSVASINSLQEPQ
FT                   LAVPNDASAGIPLNSIIAVYMLDDGRPSSMVEVAYLDERLHKAAFVQMQTSDLQELNLW
FT                   MIGIRSAAEMTRNADPLPFDQKSVEYVSRMLEYERDYDPETFRMFRVIQMACSSKATTR
FT                   ASSDDLTKLSPTGCYLALGSHKLHLIPLHKISSRSSVVSMSDLETATSFGLMNLTGLSM
FT                   EWGDDSLHLTFRLPLGKPYSVFLASVHSLEVAFWIRQQTEFLRPLWLRQPYDFIVPRDL
FT                   NHSSNYPPVSLDEDYGCFDRTLVAYSASYDIDTSNIRYTIDMQCDNAPCFRLLPPASPH
FT                   RQKYTALELIAVLRALRYNESFCSISFSRVSLDALQGVRDFHGVDTDALLTRSGTPIHI
FT                   PGQENLSVLSQEIRALALKSTCLNRLDFSYTLSRTPRSDSESHDPGCGIPEALFPVCRR
FT                   QLTSVDCVALNGIRLGDSDLDYLVDAASQKGSHLRALEVGHCGMTVHDVDLLLSTLVTQ
FT                   ASTLEAVDLSGIQGRLGPGLLQQYLGHFGKLRKLDLSRVSRTSGPEALISPETLFRWRL
FT                   QELSLSGTAVNRETVDAIATYLASDQSRDLRILRLDQCGLTGQDVAIFLHSIAVVGAPR
FT                   DLHLYVSENRLDLGCSYLFDAIAQNKTPSHLSMRMIDFKREEQFQDLVEALRINRTLKY
FT                   LDISKASLPYDAGPETCRSLQLMFEENSTLESLDISGESAHLDVARFGIGLNLALTGLK
FT                   KNKSLKVLKIEHQKLGFQGASTLASVLEENTCLREVYCENNDINLQSFTVLVNGLQRNR
FT                   TILNLSSMDQDRVQSLDKFRREIENVKRDLSHAQSSTTSSIRRSIHAAIHVKNATVGNK
FT                   LSKHSSAANPTRSMTSPSLSSASTTAVAASHVMDHDVEIILQSLNEKWDSEVARLRRYL
FT                   FRNYSVANGIDDGYDDAASDGRPTTAASLGTMLENLKLNGPEFSEEEPTLSQTSLQATP
FT                   QSDEKADSPTPSTASTESKSSHLDIFKSLDADSGFRAELGDRPQTAGDVLTHGSAGLPR
FT                   EYSTSNAPSARLAVPVPAMPSITVKPNSVRSARSSSSMSTSAGTTMSSRSTYGTASSTL
FT                   RGFLSKGVSKDRRGLDKLKPGPLCVSSDAPPQLDWTPPQLELRGFR"
     MADSLGKKER RKSLSVFSPS STTSILSGSA ISHDRSPSDD VNTLKKKNRR NSGFFGVRNT        60
     SPARTPGNNA QHWPDTIESE STAACIASTP TIIVPETTTR SRRKSLQKRR TSVFGSLRSL       120
     HSLDDDEKSL GRVKGSPVDD EDAFASRNGI GSAILHHGAI QTTGGMWRKK SQYLVLTDTH       180
     LVRFKSQSKA AEMFSSIPAS YTRSPAMNRQ SVASINSLQE PQLAVPNDAS AGIPLNSIIA       240
     VYMLDDGRPS SMVEVAYLDE RLHKAAFVQM QTSDLQELNL WMIGIRSAAE MTRNADPLPF       300
     DQKSVEYVSR MLEYERDYDP ETFRMFRVIQ MACSSKATTR ASSDDLTKLS PTGCYLALGS       360
     HKLHLIPLHK ISSRSSVVSM SDLETATSFG LMNLTGLSME WGDDSLHLTF RLPLGKPYSV       420
     FLASVHSLEV AFWIRQQTEF LRPLWLRQPY DFIVPRDLNH SSNYPPVSLD EDYGCFDRTL       480
     VAYSASYDID TSNIRYTIDM QCDNAPCFRL LPPASPHRQK YTALELIAVL RALRYNESFC       540
     SISFSRVSLD ALQGVRDFHG VDTDALLTRS GTPIHIPGQE NLSVLSQEIR ALALKSTCLN       600
     RLDFSYTLSR TPRSDSESHD PGCGIPEALF PVCRRQLTSV DCVALNGIRL GDSDLDYLVD       660
     AASQKGSHLR ALEVGHCGMT VHDVDLLLST LVTQASTLEA VDLSGIQGRL GPGLLQQYLG       720
     HFGKLRKLDL SRVSRTSGPE ALISPETLFR WRLQELSLSG TAVNRETVDA IATYLASDQS       780
     RDLRILRLDQ CGLTGQDVAI FLHSIAVVGA PRDLHLYVSE NRLDLGCSYL FDAIAQNKTP       840
     SHLSMRMIDF KREEQFQDLV EALRINRTLK YLDISKASLP YDAGPETCRS LQLMFEENST       900
     LESLDISGES AHLDVARFGI GLNLALTGLK KNKSLKVLKI EHQKLGFQGA STLASVLEEN       960
     TCLREVYCEN NDINLQSFTV LVNGLQRNRT ILNLSSMDQD RVQSLDKFRR EIENVKRDLS      1020
     HAQSSTTSSI RRSIHAAIHV KNATVGNKLS KHSSAANPTR SMTSPSLSSA STTAVAASHV      1080
     MDHDVEIILQ SLNEKWDSEV ARLRRYLFRN YSVANGIDDG YDDAASDGRP TTAASLGTML      1140
     ENLKLNGPEF SEEEPTLSQT SLQATPQSDE KADSPTPSTA STESKSSHLD IFKSLDADSG      1200
     FRAELGDRPQ TAGDVLTHGS AGLPREYSTS NAPSARLAVP VPAMPSITVK PNSVRSARSS      1260
     SSMSTSAGTT MSSRSTYGTA SSTLRGFLSK GVSKDRRGLD KLKPGPLCVS SDAPPQLDWT      1320
     PPQLELRGFR                                                             1330
//

If you have problems or comments...

PBIL Back to PBIL home page