(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE36

ASFUM1_6.PE36        Location/Qualifiers
FT   CDS             join(complement(121539..121669),complement(121114..121306))
FT                   /codon_start=1
FT                   /gene_family="HOG000048657" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055869"
FT                   /orf_name="AFUA_6G00480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84217.1"
FT                   /db_xref="HOGENOM:HBG056297"
FT                   /db_xref="UniParc:UPI000051EFE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W902"
FT                   /transl_table=1
FT                   /translation="MILWSWTGIYVALVWMESGKWGGLKMPDVMILNASQQPFLSKAFT
FT                   RTVGKSSESERPLMGGTGVGRQGPRDEAVKEQMADRQHTVSGMMEMSRLQLSDIVQGIL
FT                   AES"
     MILWSWTGIY VALVWMESGK WGGLKMPDVM ILNASQQPFL SKAFTRTVGK SSESERPLMG        60
     GTGVGRQGPR DEAVKEQMAD RQHTVSGMME MSRLQLSDIV QGILAES                     107
//

If you have problems or comments...

PBIL Back to PBIL home page