(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE369

ASFUM1_6.PE369       Location/Qualifiers
FT   CDS             join(1145681..1145702,1145801..1145845,1145919..1147037,
FT                   1147100..1147581)
FT                   /codon_start=1
FT                   /gene_family="HOG000200782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265347"
FT                   /orf_name="AFUA_6G04860"
FT                   /product="MBOAT family protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85553.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG328785"
FT                   /db_xref="HOGENOM:HBG737510"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI0000F51CD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI5"
FT                   /transl_table=1
FT                   /translation="MLPYVDTIFGYPARLTGASVDELKLIASFLLSYPLAGLLKRIPDA
FT                   HPWKKNVFIIAVSLFYLVGLFDLWDGLRTLLYSAAGTYAIAYYIDGSLMPWIGFVFLMG
FT                   HMSISHIYRQMVDDPQVVDITGAQMVLVMKLSSFCWNIHDGRLPQDKLSDPQKYASIAQ
FT                   FPSILDYAGYVLFFPSLFGGPSFEYVDYRRWLDTTLFEVPPGTDPSKVPPTRKKRKIPR
FT                   SGTPATKKALMGLVWIFVFLQLGSLYNKESVLGESFLSYSFLRRVWILYMLGFTTRTKY
FT                   YGVWSLTEGACILSGLGYNGFDPKTGKVFWNRLDNIDPWSLETAQNSHGYLGSWNKNTN
FT                   HWLRNYVYLRVTPKGKKPGFRASLATFTTSAFWHGFYPGYYMTFILGSFVQTGAKNIRR
FT                   YIRPFFLTPDGAKPLPTKRYYDILSWLVTQLTMSFVVMPFIFLSFSSSIQVWRSVYFYG
FT                   IIGNIMSIIFFASPAKGYLVRSLKKRNKPHIPRTASMESLQQPTLGLPNDPAREFDDAV
FT                   QEIKAEFEARRRRGSVVGVPTGEELKAAVEAKLGRKIS"
     MLPYVDTIFG YPARLTGASV DELKLIASFL LSYPLAGLLK RIPDAHPWKK NVFIIAVSLF        60
     YLVGLFDLWD GLRTLLYSAA GTYAIAYYID GSLMPWIGFV FLMGHMSISH IYRQMVDDPQ       120
     VVDITGAQMV LVMKLSSFCW NIHDGRLPQD KLSDPQKYAS IAQFPSILDY AGYVLFFPSL       180
     FGGPSFEYVD YRRWLDTTLF EVPPGTDPSK VPPTRKKRKI PRSGTPATKK ALMGLVWIFV       240
     FLQLGSLYNK ESVLGESFLS YSFLRRVWIL YMLGFTTRTK YYGVWSLTEG ACILSGLGYN       300
     GFDPKTGKVF WNRLDNIDPW SLETAQNSHG YLGSWNKNTN HWLRNYVYLR VTPKGKKPGF       360
     RASLATFTTS AFWHGFYPGY YMTFILGSFV QTGAKNIRRY IRPFFLTPDG AKPLPTKRYY       420
     DILSWLVTQL TMSFVVMPFI FLSFSSSIQV WRSVYFYGII GNIMSIIFFA SPAKGYLVRS       480
     LKKRNKPHIP RTASMESLQQ PTLGLPNDPA REFDDAVQEI KAEFEARRRR GSVVGVPTGE       540
     ELKAAVEAKL GRKIS                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page