(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE37

ASFUM1_6.PE37        Location/Qualifiers
FT   CDS             join(121680..123395,123508..123618)
FT                   /codon_start=1
FT                   /gene_family="HOG000149415" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262219"
FT                   /orf_name="AFUA_6G00490"
FT                   /product="DUF521 domain protein"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /biological_process="phosphorylation"
FT                   /protein_id="EAL84216.1"
FT                   /db_xref="GO:0016310"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG402504"
FT                   /db_xref="HOGENOM:HBG410537"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR012047"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="UniParc:UPI000051E42C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W903"
FT                   /transl_table=1
FT                   /translation="MQYHGHCLVDSAATGKLLYANVGLSFWAGVDSQTGEIIDRHHPLH
FT                   GQSVNGRILAIPCSRGSCTGSIVLIELLLNQCAPAGLIFQQPEQIITLGVVVAKTLLGL
FT                   SIPVLVLKPAEFHSLKDYRYAAITGPTLQTGEDPLPPPTYEAPSCAPSGTIDLSETDEA
FT                   ILHGARGAAAQKAMEILLSFAQIQGATRLIDISRAHIDACIYTGPASLRIPQTFLSLGA
FT                   RVAIPTTLNSISIDRRRWRELGVKEELAVPADQLVETYLAMGARPVFTCAPYLLESAPA
FT                   AGQDIGWSESNAVVFANSVLGARTQKYPDLIDVCIALTGRAPLAGGHADEGRTPSVVVE
FT                   VADFPKMDDAVWPLLGYHIGQLAGGDIPLVVGLEQTKPRMADLKAFGAAFATTASASMF
FT                   HVRGVTPEATKFEGVRHTAKRMAVHESDLVRTWEDLNTAQDSSVGLVSLGNPHFSLEEF
FT                   ESFSRLCADRKKDPSVQMMITTGRETYELAASKGYIQTLEAFGATIITDTCWCMIREPV
FT                   IPPQTINLMTNSAKYAHYAPGMVQRGVHFGSLAQCVVASCTGYFDGEPSWKQDCTLPCE
FT                   AEVYTLMTEGLPPHPNSHRFATNLGDENRCIA"
     MQYHGHCLVD SAATGKLLYA NVGLSFWAGV DSQTGEIIDR HHPLHGQSVN GRILAIPCSR        60
     GSCTGSIVLI ELLLNQCAPA GLIFQQPEQI ITLGVVVAKT LLGLSIPVLV LKPAEFHSLK       120
     DYRYAAITGP TLQTGEDPLP PPTYEAPSCA PSGTIDLSET DEAILHGARG AAAQKAMEIL       180
     LSFAQIQGAT RLIDISRAHI DACIYTGPAS LRIPQTFLSL GARVAIPTTL NSISIDRRRW       240
     RELGVKEELA VPADQLVETY LAMGARPVFT CAPYLLESAP AAGQDIGWSE SNAVVFANSV       300
     LGARTQKYPD LIDVCIALTG RAPLAGGHAD EGRTPSVVVE VADFPKMDDA VWPLLGYHIG       360
     QLAGGDIPLV VGLEQTKPRM ADLKAFGAAF ATTASASMFH VRGVTPEATK FEGVRHTAKR       420
     MAVHESDLVR TWEDLNTAQD SSVGLVSLGN PHFSLEEFES FSRLCADRKK DPSVQMMITT       480
     GRETYELAAS KGYIQTLEAF GATIITDTCW CMIREPVIPP QTINLMTNSA KYAHYAPGMV       540
     QRGVHFGSLA QCVVASCTGY FDGEPSWKQD CTLPCEAEVY TLMTEGLPPH PNSHRFATNL       600
     GDENRCIA                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page