(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE376

ASFUM1_6.PE376       Location/Qualifiers
FT   CDS             join(1165667..1166862,1166918..1170287,1170346..1171182)
FT                   /codon_start=1
FT                   /gene_family="HOG000200715" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903383"
FT                   /orf_name="AFUA_6G04940"
FT                   /product="Cytokinesis protein SepA/Bni1 "
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /protein_id="EAL85546.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="HOGENOM:HBG056100"
FT                   /db_xref="HOGENOM:HBG328035"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR010472"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR014767"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051FB51"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ2"
FT                   /transl_table=1
FT                   /translation="MPTTTSASDKSRQTSAGKGFFGRKLHKEKPVDDRYEGYGGSENLA
FT                   PPGNATGSRSSRHSKRSSVQSVDYSHDFDPSGISMTAGVITSIPYESLTTDTRSPIPVD
FT                   YLSRAETSPRKEPSPNHLAKGGGDFHQYPAWNPTGLRENNAFSHPTGPRPPPHASNVSM
FT                   VGSTAGDKSARHQQWARPGSSATNAGFSHNSSSTVDSSSTSRMSFDQTSIHSSLSSNTR
FT                   GSSYISSDGSARTLTTSHSGDRGTLFPSSGNSNRFSTAQAAWQAAQLATHSAAPVLNPE
FT                   QYLTRPRDDRVVDQLFLDLMQKRGWQNLPEQAKRQMLAYPASKKWTLVHQDRLTELQGE
FT                   QKRRQNARQTHGHDGPAGILERADEEGSPEWYVKKVMDDSITSKQLASLSVSLRTQPIN
FT                   WVRAFVEAQGQIALTNVLSKINRRKASGPVPAPPTGDRDLDREYDIVKCLKALMNNKYG
FT                   ADDAIGHQQVIIALVSSLLSPRLNTRKLVSEVLTFLCHWAEGEGHQKVLQAMDHVKNQH
FT                   GETGRFDAWMRIVEVTIDGRGKMGSLVGASEEYRSGGIGMENLLMEYAVSTMMLINMLV
FT                   DAPENDLQLRCHIRAQFISCGIKRLLTKMEGFQYEVIDKQIERFRENEAIDYEDLLQRE
FT                   SSSMKDSIEGEVKDMSDPLQITDAILTRLNGTRAYDYFLSAMQHMLLIRENSGEDGLRM
FT                   FQLVDAMLSYVAMDRRLPDLDFRQGLTFTVQSLLDRLHTDAEARRAYDESLEARQIAEA
FT                   AIAERDEMKAQVEMGADGLVKKLQKQIDEQTSIIELQTRQNDALKAELADVQRLRAQEL
FT                   QRNELETRELYLMLRDAQDIAASNAKKNNLAETDPSHMRGILDRERLLERLEKQLERTK
FT                   TQFKLEGKVWGQHGPSDRLRELREQMDGEPDPEDFQEQARRNLETSALGSVHRKRSHVP
FT                   EMDVANGQERPSHQDGPLLVNFGRPRMDPEQASDLLGEIASKVPKIDAEDAETDEFNAQ
FT                   PTQLETEEARVGQVEEVKPEDETEKPEEKPVSVPAPPPPPPPPPPPPPPGGAVGIPPPP
FT                   PPPPPPPPPPGAKGLGVPPPPPPPPPPGFAGGMPPPPPPPPGRFGAPPPPPPPGVGGGW
FT                   RSNYIASQSAPSHPTAVLSSIRPKKKLKALHWDKVDTPQVTVWAIRDPTPQAKEQKYSE
FT                   LAKKGVLDEVERLFMAKETKIFGAGSGAKQRKDKKQIISNDLSKTFQIALAKFSQYPID
FT                   DVVRMIIHCDPEILDNMVVMDFLQREDMCTIPENVSKLMAPYSKDWTGPDAASSEREQD
FT                   PTELTREDQIYLYTAFELNHYWKARMRALALTRSFEPDYEHLSTKIREVVRVSESLRDS
FT                   VSLMNVLGLILDIGNFMNDANKQAQGFKLSSLARLGMVKDDKNETTFADLVERIVRNQY
FT                   PEWEGFVDEIGGVIGVQKINVDQLRADAKKYIDNIKNVQASLDAGNLSDPKKFHPQDRV
FT                   SQIVQRSMKDARRKAEQMQLYLEEMVKTYDDIMVFYGEDNTDEGARRDFFAKLASFLVE
FT                   WKKSKEKNIALEEARKRTEASLARKRVNAGLANSSGAGDAPVSPATSGAMDSLLEKLRA
FT                   AAPQARDQRDRRRRARLKERHQVRIASGQKIPDLTGSEPANGETQANNNSATPVGGNDA
FT                   NTIETGLLSPPAQETDVDTPTKELQVSESEDVADRAASMLQGLRDNLDNNGERARRRRE
FT                   SAEEERRKRRLRRRNGGTASKDSADGSTLSSVPEPATPPPSTEVSALSEPGMASPSNDE
FT                   NGTSQPPQTRSIVVSPNADEHHGSPGNEKSLDGSPKHQPTEQSA"
     MPTTTSASDK SRQTSAGKGF FGRKLHKEKP VDDRYEGYGG SENLAPPGNA TGSRSSRHSK        60
     RSSVQSVDYS HDFDPSGISM TAGVITSIPY ESLTTDTRSP IPVDYLSRAE TSPRKEPSPN       120
     HLAKGGGDFH QYPAWNPTGL RENNAFSHPT GPRPPPHASN VSMVGSTAGD KSARHQQWAR       180
     PGSSATNAGF SHNSSSTVDS SSTSRMSFDQ TSIHSSLSSN TRGSSYISSD GSARTLTTSH       240
     SGDRGTLFPS SGNSNRFSTA QAAWQAAQLA THSAAPVLNP EQYLTRPRDD RVVDQLFLDL       300
     MQKRGWQNLP EQAKRQMLAY PASKKWTLVH QDRLTELQGE QKRRQNARQT HGHDGPAGIL       360
     ERADEEGSPE WYVKKVMDDS ITSKQLASLS VSLRTQPINW VRAFVEAQGQ IALTNVLSKI       420
     NRRKASGPVP APPTGDRDLD REYDIVKCLK ALMNNKYGAD DAIGHQQVII ALVSSLLSPR       480
     LNTRKLVSEV LTFLCHWAEG EGHQKVLQAM DHVKNQHGET GRFDAWMRIV EVTIDGRGKM       540
     GSLVGASEEY RSGGIGMENL LMEYAVSTMM LINMLVDAPE NDLQLRCHIR AQFISCGIKR       600
     LLTKMEGFQY EVIDKQIERF RENEAIDYED LLQRESSSMK DSIEGEVKDM SDPLQITDAI       660
     LTRLNGTRAY DYFLSAMQHM LLIRENSGED GLRMFQLVDA MLSYVAMDRR LPDLDFRQGL       720
     TFTVQSLLDR LHTDAEARRA YDESLEARQI AEAAIAERDE MKAQVEMGAD GLVKKLQKQI       780
     DEQTSIIELQ TRQNDALKAE LADVQRLRAQ ELQRNELETR ELYLMLRDAQ DIAASNAKKN       840
     NLAETDPSHM RGILDRERLL ERLEKQLERT KTQFKLEGKV WGQHGPSDRL RELREQMDGE       900
     PDPEDFQEQA RRNLETSALG SVHRKRSHVP EMDVANGQER PSHQDGPLLV NFGRPRMDPE       960
     QASDLLGEIA SKVPKIDAED AETDEFNAQP TQLETEEARV GQVEEVKPED ETEKPEEKPV      1020
     SVPAPPPPPP PPPPPPPPGG AVGIPPPPPP PPPPPPPPGA KGLGVPPPPP PPPPPGFAGG      1080
     MPPPPPPPPG RFGAPPPPPP PGVGGGWRSN YIASQSAPSH PTAVLSSIRP KKKLKALHWD      1140
     KVDTPQVTVW AIRDPTPQAK EQKYSELAKK GVLDEVERLF MAKETKIFGA GSGAKQRKDK      1200
     KQIISNDLSK TFQIALAKFS QYPIDDVVRM IIHCDPEILD NMVVMDFLQR EDMCTIPENV      1260
     SKLMAPYSKD WTGPDAASSE REQDPTELTR EDQIYLYTAF ELNHYWKARM RALALTRSFE      1320
     PDYEHLSTKI REVVRVSESL RDSVSLMNVL GLILDIGNFM NDANKQAQGF KLSSLARLGM      1380
     VKDDKNETTF ADLVERIVRN QYPEWEGFVD EIGGVIGVQK INVDQLRADA KKYIDNIKNV      1440
     QASLDAGNLS DPKKFHPQDR VSQIVQRSMK DARRKAEQMQ LYLEEMVKTY DDIMVFYGED      1500
     NTDEGARRDF FAKLASFLVE WKKSKEKNIA LEEARKRTEA SLARKRVNAG LANSSGAGDA      1560
     PVSPATSGAM DSLLEKLRAA APQARDQRDR RRRARLKERH QVRIASGQKI PDLTGSEPAN      1620
     GETQANNNSA TPVGGNDANT IETGLLSPPA QETDVDTPTK ELQVSESEDV ADRAASMLQG      1680
     LRDNLDNNGE RARRRRESAE EERRKRRLRR RNGGTASKDS ADGSTLSSVP EPATPPPSTE      1740
     VSALSEPGMA SPSNDENGTS QPPQTRSIVV SPNADEHHGS PGNEKSLDGS PKHQPTEQSA      1800
//

If you have problems or comments...

PBIL Back to PBIL home page