(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE378

ASFUM1_6.PE378       Location/Qualifiers
FT   CDS             join(complement(1179462..1179907),
FT                   complement(1176704..1179409),complement(1175883..1176072))
FT                   /codon_start=1
FT                   /gene_family="HOG000200692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056662"
FT                   /orf_name="AFUA_6G04960"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL85544.1"
FT                   /db_xref="HOGENOM:HBG056089"
FT                   /db_xref="HOGENOM:HBG328012"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051E5AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ4"
FT                   /transl_table=1
FT                   /translation="MDPFTWIGAISGVLQIAQVISQTTAGLVKLKGRFSNADLTIQSLI
FT                   GELSIIESALTHLEDWAKFNARVTTKSEEYIEGLNVALDGCRAVMEVLSEEVASLVQNI
FT                   TGQDSIVGFRARVKVVWNEDVMRGHQERLHAQVVALQLLLQACQCRSSSEQVELLRRAE
FT                   NRQIIKKVADDTATLRSSSYAGSQAHGSSWSFYQPSVSNVASDLDRVLASSPSIRYAGH
FT                   HFQSKSDIDEGYASAATTGRSFSQTNCFSLPLRPNDSVVMSNGHSTSVTLQHAPRQYSQ
FT                   SQVRRSHSDSKPPSSARPPLGSKRERIRSVFRQFSRSSLKSSSSMSPGLSPTASRVARA
FT                   VDEKVLKTSIDLTAPEGATAPLIVKLAQSGGLADIEMLIESGHGVDARHLSTRRTALLV
FT                   AAHCGNEAVVNLLIQKNARLDAVDAWGSTALHLAASRGHCDVIQLLLLEPLDREARDAQ
FT                   GRTALWLAAGRGQLEATRLLVAHHAKVNVRAENHTTPLHAAAKRGDEEMVELLISCGAD
FT                   LEARDGAMMTALHYACEEGHLGVMKLLLDNRANINVPGSDRRTPLICSAAMGRCPVAQE
FT                   LLKRKASAHCVDDASMTAVHWAAFNGHIEIVDLLSQKKGVLTATNKLGRTALHLAAMNS
FT                   RFAVIELLVRKGVPVDARCHDGLTPLHYACLANSLEIARLLLISSANIEAQTEINKQRP
FT                   IHIAAARGSMNILNLLCDKGASLEARDAKGDRALGVASRHGHAAAVQNLLERGCPLYLA
FT                   YETRPQEDSPLCLAAMGGHLPVVSLLLQHGASVVRRDESGWQPHHYAAYYGHPDVLALL
FT                   LHHGPASANDGTRFGLDAAGIGFAPHAIISEERKAQVRQLLNQDSGQFVAQTQIPAFQP
FT                   PQAIGETLHNRTIAPQLPLTTRSLEPCAEPSAMAPQELPVTLEQGLPPSRSVTPEHMRG
FT                   GRRTSIGLRSSSSQSRQFEAAVQSSSSGTAPRQPEPSLSHTGSTSEPWFDYSLPYWRGS
FT                   PVSTVHETGTEVEVLAPQPGRGTVSKLPLLSTFNPVDPVCEPTGIMNSDSESSSSVYTA
FT                   REKTPCSGNNGTSNSGGGLRGAVSWNRRSNPDNRIDAGDDLVLKGYKVRTSGDSGARRE
FT                   TSIIET"
     MDPFTWIGAI SGVLQIAQVI SQTTAGLVKL KGRFSNADLT IQSLIGELSI IESALTHLED        60
     WAKFNARVTT KSEEYIEGLN VALDGCRAVM EVLSEEVASL VQNITGQDSI VGFRARVKVV       120
     WNEDVMRGHQ ERLHAQVVAL QLLLQACQCR SSSEQVELLR RAENRQIIKK VADDTATLRS       180
     SSYAGSQAHG SSWSFYQPSV SNVASDLDRV LASSPSIRYA GHHFQSKSDI DEGYASAATT       240
     GRSFSQTNCF SLPLRPNDSV VMSNGHSTSV TLQHAPRQYS QSQVRRSHSD SKPPSSARPP       300
     LGSKRERIRS VFRQFSRSSL KSSSSMSPGL SPTASRVARA VDEKVLKTSI DLTAPEGATA       360
     PLIVKLAQSG GLADIEMLIE SGHGVDARHL STRRTALLVA AHCGNEAVVN LLIQKNARLD       420
     AVDAWGSTAL HLAASRGHCD VIQLLLLEPL DREARDAQGR TALWLAAGRG QLEATRLLVA       480
     HHAKVNVRAE NHTTPLHAAA KRGDEEMVEL LISCGADLEA RDGAMMTALH YACEEGHLGV       540
     MKLLLDNRAN INVPGSDRRT PLICSAAMGR CPVAQELLKR KASAHCVDDA SMTAVHWAAF       600
     NGHIEIVDLL SQKKGVLTAT NKLGRTALHL AAMNSRFAVI ELLVRKGVPV DARCHDGLTP       660
     LHYACLANSL EIARLLLISS ANIEAQTEIN KQRPIHIAAA RGSMNILNLL CDKGASLEAR       720
     DAKGDRALGV ASRHGHAAAV QNLLERGCPL YLAYETRPQE DSPLCLAAMG GHLPVVSLLL       780
     QHGASVVRRD ESGWQPHHYA AYYGHPDVLA LLLHHGPASA NDGTRFGLDA AGIGFAPHAI       840
     ISEERKAQVR QLLNQDSGQF VAQTQIPAFQ PPQAIGETLH NRTIAPQLPL TTRSLEPCAE       900
     PSAMAPQELP VTLEQGLPPS RSVTPEHMRG GRRTSIGLRS SSSQSRQFEA AVQSSSSGTA       960
     PRQPEPSLSH TGSTSEPWFD YSLPYWRGSP VSTVHETGTE VEVLAPQPGR GTVSKLPLLS      1020
     TFNPVDPVCE PTGIMNSDSE SSSSVYTARE KTPCSGNNGT SNSGGGLRGA VSWNRRSNPD      1080
     NRIDAGDDLV LKGYKVRTSG DSGARRETSI IET                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page