(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE383

ASFUM1_6.PE383       Location/Qualifiers
FT   CDS             join(complement(1192148..1192186),
FT                   complement(1191888..1191979),complement(1190765..1191784),
FT                   complement(1190106..1190703),complement(1189724..1190038))
FT                   /codon_start=1
FT                   /gene_family="HOG000200670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751325"
FT                   /orf_name="AFUA_6G05010"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85539.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056059"
FT                   /db_xref="HOGENOM:HBG327957"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000520219"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ9"
FT                   /transl_table=1
FT                   /translation="MNPSPTNAVKKTPCSLSQPCRACSQMGFECLFLQPQKKRGPTGNR
FT                   VSQIRQQQQTQLLRKSSQSSLSDAYPYQRPITSRETGQHGVAPSVQDPTQWPIPQRGEA
FT                   SVSTDVVPPRSNTSIGPSWPATDTSSVDSQTNSAISWNERSDVEYWLPDNLDAQVPVFE
FT                   FPGSNIYLKASLPSIIQPEQEAAGLQPHHVDTSNLALSTMGVMPAGPVPTRTTWPASIV
FT                   EANMIPWIEVYFDRLHPTLPVLNRSSLFIRMLAQEHRRNPQFGAMLLSLCAFSLTQPIE
FT                   IDERPTSSSRASQARSMMNEATKMRSCSDFGEHPTIEAVLTSFFLFGCLFGSNQHNAAW
FT                   LRLREALDLAATLGLNNPDSYRDIPNDERGQRLRTYLVLSITERAYALQRRHPITFWGR
FT                   PGFTMRSVHDFIHNATHSVVSGIIVHNEKDAEGMLGLARLMELFDAIDEEVVDCWNQRC
FT                   NVNSGYCNNLTEEKALSIHQNLRRVCESERYKGYDWFERTKSVPGEVQSVQPTISMRET
FT                   QCADVFITKKWLQNRVWVLCSTHGLLRPVSDHPELSFEYAITVAVDALKICQSLRLSSM
FT                   EAHGIGLVEKLYDIAVSAIGISANVRQPLGEHSTASVAGSMAGPGVAPPGSLVGAMSPN
FT                   TAAVHSTQSLAEDFMLLLNTLRGGNHPFMEKFKAYLSSLHIVGVGCSNWAQT"
     MNPSPTNAVK KTPCSLSQPC RACSQMGFEC LFLQPQKKRG PTGNRVSQIR QQQQTQLLRK        60
     SSQSSLSDAY PYQRPITSRE TGQHGVAPSV QDPTQWPIPQ RGEASVSTDV VPPRSNTSIG       120
     PSWPATDTSS VDSQTNSAIS WNERSDVEYW LPDNLDAQVP VFEFPGSNIY LKASLPSIIQ       180
     PEQEAAGLQP HHVDTSNLAL STMGVMPAGP VPTRTTWPAS IVEANMIPWI EVYFDRLHPT       240
     LPVLNRSSLF IRMLAQEHRR NPQFGAMLLS LCAFSLTQPI EIDERPTSSS RASQARSMMN       300
     EATKMRSCSD FGEHPTIEAV LTSFFLFGCL FGSNQHNAAW LRLREALDLA ATLGLNNPDS       360
     YRDIPNDERG QRLRTYLVLS ITERAYALQR RHPITFWGRP GFTMRSVHDF IHNATHSVVS       420
     GIIVHNEKDA EGMLGLARLM ELFDAIDEEV VDCWNQRCNV NSGYCNNLTE EKALSIHQNL       480
     RRVCESERYK GYDWFERTKS VPGEVQSVQP TISMRETQCA DVFITKKWLQ NRVWVLCSTH       540
     GLLRPVSDHP ELSFEYAITV AVDALKICQS LRLSSMEAHG IGLVEKLYDI AVSAIGISAN       600
     VRQPLGEHST ASVAGSMAGP GVAPPGSLVG AMSPNTAAVH STQSLAEDFM LLLNTLRGGN       660
     HPFMEKFKAY LSSLHIVGVG CSNWAQT                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page