(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE385

ASFUM1_6.PE385       Location/Qualifiers
FT   CDS             join(1195846..1195951,1196011..1196588,1196666..1196769,
FT                   1196827..1196956)
FT                   /codon_start=1
FT                   /gene_family="HOG000251649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903384"
FT                   /orf_name="AFUA_6G05030"
FT                   /product="Polysaccharide deacetylase family protein "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85537.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG048398"
FT                   /db_xref="HOGENOM:HBG508050"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniParc:UPI000051FDAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK1"
FT                   /transl_table=1
FT                   /translation="MGKKRVLVAYGVDIDAVAGWLGSYGGEDSSNDISRGLWAGHVGTP
FT                   RLLKLFDKYNIKATWFIPGHSLETFPEECAQVRDAGHEIGLHGYSHENPSDMTPEQQKD
FT                   VLDKTYRMLTDFCGRPPRGIVAPWWETSKEMADLLLAYGIEYDHSMSHHDCQMYWLRTG
FT                   DTWTKIDYSQKAETWMKPLVRGQDTGLVEIPGNWYIDDLPPMMFIKNAPNSHGWVNPRD
FT                   IEDIWKDHFDYFYREYDSFVFPMTIHPDVSGRPHVLLMHERIIEHINKHEGVEWVTFEQ
FT                   MCDEFKKNNKPPEGAKMPVTPVLE"
     MGKKRVLVAY GVDIDAVAGW LGSYGGEDSS NDISRGLWAG HVGTPRLLKL FDKYNIKATW        60
     FIPGHSLETF PEECAQVRDA GHEIGLHGYS HENPSDMTPE QQKDVLDKTY RMLTDFCGRP       120
     PRGIVAPWWE TSKEMADLLL AYGIEYDHSM SHHDCQMYWL RTGDTWTKID YSQKAETWMK       180
     PLVRGQDTGL VEIPGNWYID DLPPMMFIKN APNSHGWVNP RDIEDIWKDH FDYFYREYDS       240
     FVFPMTIHPD VSGRPHVLLM HERIIEHINK HEGVEWVTFE QMCDEFKKNN KPPEGAKMPV       300
     TPVLE                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page