(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE386

ASFUM1_6.PE386       Location/Qualifiers
FT   CDS             join(complement(1198456..1198544),
FT                   complement(1198175..1198399),complement(1198029..1198112),
FT                   complement(1197553..1197975),complement(1197270..1197495))
FT                   /codon_start=1
FT                   /gene_family="HOG000224155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265352"
FT                   /orf_name="AFUA_6G05040"
FT                   /product="DNA replication factor C subunit Rfc4, putative "
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="EAL85536.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG533331"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI000051EEFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK2"
FT                   /transl_table=1
FT                   /translation="MVQAESSASASRNSLRAVTAGAPPDYELPWVEKYRPIFLDDIVGN
FT                   TETIERLKIIAKDGNMPHVIISGMPGIGKTTSILCLARQLLGEAYKEAVLELNASDERG
FT                   ISRIKGFAQKKVTLPPGRHKIVILDEADSMTPGAQQALRRTMEIYSSTTRFAFACNQSN
FT                   KIIEPIQSRCAILRYARLTDAQVVKRLKQICDAEKVEHTEDGIAALVFSAEGDMRQAIN
FT                   NLQSTWSGFGLVSGDNVFRVVDSPHPIKVQAMIKACWEGKVDAALETLNELWDLGYSSH
FT                   DIISTMFRVTKTIPTLSEHSKLEFIREIGFTHMRILDGVQSLLQLSGCVSKLCKINMKP
FT                   QLFEPPKA"
     MVQAESSASA SRNSLRAVTA GAPPDYELPW VEKYRPIFLD DIVGNTETIE RLKIIAKDGN        60
     MPHVIISGMP GIGKTTSILC LARQLLGEAY KEAVLELNAS DERGISRIKG FAQKKVTLPP       120
     GRHKIVILDE ADSMTPGAQQ ALRRTMEIYS STTRFAFACN QSNKIIEPIQ SRCAILRYAR       180
     LTDAQVVKRL KQICDAEKVE HTEDGIAALV FSAEGDMRQA INNLQSTWSG FGLVSGDNVF       240
     RVVDSPHPIK VQAMIKACWE GKVDAALETL NELWDLGYSS HDIISTMFRV TKTIPTLSEH       300
     SKLEFIREIG FTHMRILDGV QSLLQLSGCV SKLCKINMKP QLFEPPKA                    348
//

If you have problems or comments...

PBIL Back to PBIL home page