(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE388

ASFUM1_6.PE388       Location/Qualifiers
FT   CDS             join(complement(1201126..1201169),
FT                   complement(1200771..1201027),complement(1200465..1200617),
FT                   complement(1199826..1200412))
FT                   /codon_start=1
FT                   /gene_family="HOG000200648" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265353"
FT                   /orf_name="AFUA_6G05050"
FT                   /product="DUF410 domain protein"
FT                   /protein_id="EAL85534.1"
FT                   /db_xref="HOGENOM:HBG060032"
FT                   /db_xref="HOGENOM:HBG397316"
FT                   /db_xref="InterPro:IPR007317"
FT                   /db_xref="UniParc:UPI000051FFD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK4"
FT                   /transl_table=1
FT                   /translation="MTSRIDKTIARQREKIASGAYYEAHQQLRVIAARYIKQSNYEAAA
FT                   EILAGGATALLRAGSQQGASASGGDLAIMLVDEVYTKAGWGITGGDDDAEGRARKKRLI
FT                   ELLREFPSEEPTRKRFIQEMIGWSGRFGPVERGDAELHHAAGSVYAEDNEPYDAEKHLV
FT                   LGTSESAETLAKLEYEWYTNDEPHTAAIYASRAVFPYLLVGNLRNANKAFLVFTSRLSS
FT                   SNTSLGVQEVSSASSDVRVFPSLPLLNFISMLLLTIQRGSADLFKQLTAHYASQIREVG
FT                   IWDDALSQIGEQYFAIKVPRQGNPLLDMMGSMLFGGQNQGGSRRTPQGRSQSKTVEAPP
FT                   ASMELD"
     MTSRIDKTIA RQREKIASGA YYEAHQQLRV IAARYIKQSN YEAAAEILAG GATALLRAGS        60
     QQGASASGGD LAIMLVDEVY TKAGWGITGG DDDAEGRARK KRLIELLREF PSEEPTRKRF       120
     IQEMIGWSGR FGPVERGDAE LHHAAGSVYA EDNEPYDAEK HLVLGTSESA ETLAKLEYEW       180
     YTNDEPHTAA IYASRAVFPY LLVGNLRNAN KAFLVFTSRL SSSNTSLGVQ EVSSASSDVR       240
     VFPSLPLLNF ISMLLLTIQR GSADLFKQLT AHYASQIREV GIWDDALSQI GEQYFAIKVP       300
     RQGNPLLDMM GSMLFGGQNQ GGSRRTPQGR SQSKTVEAPP ASMELD                      346
//

If you have problems or comments...

PBIL Back to PBIL home page