(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE389

ASFUM1_6.PE389       Location/Qualifiers
FT   CDS             join(1201673..1201747,1201804..1202046,1202114..1202145,
FT                   1202198..1202234,1202355..1202448,1202503..1202673,
FT                   1202756..1203055,1203119..1203264)
FT                   /codon_start=1
FT                   /gene_family="HOG000200647" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265354"
FT                   /gene_name="rai1"
FT                   /orf_name="AFUA_6G05060"
FT                   /product="Protein rai1"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription termination, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85533.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006353"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG056022"
FT                   /db_xref="HOGENOM:HBG395893"
FT                   /db_xref="InterPro:IPR013961"
FT                   /db_xref="UniParc:UPI0000520459"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDK5"
FT                   /transl_table=1
FT                   /translation="MDGGTFDIQPIGRFYGSNTTIRRPREITCFSYDAEHKFHLGDSSL
FT                   RYYYTPRLPADLNRGFDTFQKLDDTADEHLDALLETIMALEKETGKRCEADIITWRGMM
FT                   TKILTAPFDNLNGFEMNATCFQVGGENNLYKIQQKQIQENQRMPPGMASQDLMAYWGYK
FT                   FETLCLLQQPWDPTPRAEIESREDLVVNNNAQYCSVVRTGIGSTRLIIGGEVDAVWDCK
FT                   PDRKEDPINWVELKTSAEIRNDRDMIKYERKLLKFWAQSFLLGVPKIIVGFRDNHGIVH
FT                   RLEELETASIPNKVKKLGRGTWDGNICINFAAAFLEWLKSTIKEGGTWRIRKLEKSSLI
FT                   QVFKIEETGTGDIISRSFLDWRSRS"
     MDGGTFDIQP IGRFYGSNTT IRRPREITCF SYDAEHKFHL GDSSLRYYYT PRLPADLNRG        60
     FDTFQKLDDT ADEHLDALLE TIMALEKETG KRCEADIITW RGMMTKILTA PFDNLNGFEM       120
     NATCFQVGGE NNLYKIQQKQ IQENQRMPPG MASQDLMAYW GYKFETLCLL QQPWDPTPRA       180
     EIESREDLVV NNNAQYCSVV RTGIGSTRLI IGGEVDAVWD CKPDRKEDPI NWVELKTSAE       240
     IRNDRDMIKY ERKLLKFWAQ SFLLGVPKII VGFRDNHGIV HRLEELETAS IPNKVKKLGR       300
     GTWDGNICIN FAAAFLEWLK STIKEGGTWR IRKLEKSSLI QVFKIEETGT GDIISRSFLD       360
     WRSRS                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page