(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE40

ASFUM1_6.PE40        Location/Qualifiers
FT   CDS             join(127197..128204,128259..128567)
FT                   /codon_start=1
FT                   /gene_family="HOG000194703" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207158"
FT                   /orf_name="AFUA_6G00520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84213.1"
FT                   /db_xref="HOGENOM:HBG053848"
FT                   /db_xref="HOGENOM:HBG327140"
FT                   /db_xref="UniParc:UPI000051ED59"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W906"
FT                   /transl_table=1
FT                   /translation="MPLFQSWTRPPSRRIYLILVSPVIGLLLVYLFFAFDTDAFTPKVV
FT                   VTPISPQQKQATCPQLGGIEDVLVILKTGVTEALEKVPVHFQTTLRCIPNYVLFSDFEE
FT                   EINGTRVIDVLGNVNETIKRTSPDFDLYNRIHEHGRSGLTPADLSRVPNTAFGMPDNPG
FT                   WKLDKWKFLPMIDETLRVRDDAKWYVFMEADTYYIWSNLLQWLAQLDPTKPYYLGNPTQ
FT                   IGSDIFGHGGSGFILSREAMRRASDLRAKDLDGWDRYTGEQWAGDCVLGKLLHDAGVPL
FT                   LWSWPMLQSNTPAEFDHFSEAYSKKPWCFPAVSYHHVGPEDIQELMKFDQMFMQNNSVI
FT                   LHSDVFRHLVHPQLKSPQPDWDNLSDEEHLIDAASCQEMCASEPDCLQYSYEAGKCRTS
FT                   KMAKIGVPKTGVSSGWMTDRIDAIVKELGSCTKPQWVLP"
     MPLFQSWTRP PSRRIYLILV SPVIGLLLVY LFFAFDTDAF TPKVVVTPIS PQQKQATCPQ        60
     LGGIEDVLVI LKTGVTEALE KVPVHFQTTL RCIPNYVLFS DFEEEINGTR VIDVLGNVNE       120
     TIKRTSPDFD LYNRIHEHGR SGLTPADLSR VPNTAFGMPD NPGWKLDKWK FLPMIDETLR       180
     VRDDAKWYVF MEADTYYIWS NLLQWLAQLD PTKPYYLGNP TQIGSDIFGH GGSGFILSRE       240
     AMRRASDLRA KDLDGWDRYT GEQWAGDCVL GKLLHDAGVP LLWSWPMLQS NTPAEFDHFS       300
     EAYSKKPWCF PAVSYHHVGP EDIQELMKFD QMFMQNNSVI LHSDVFRHLV HPQLKSPQPD       360
     WDNLSDEEHL IDAASCQEMC ASEPDCLQYS YEAGKCRTSK MAKIGVPKTG VSSGWMTDRI       420
     DAIVKELGSC TKPQWVLP                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page