(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE400

ASFUM1_6.PE400       Location/Qualifiers
FT   CDS             join(complement(1244202..1244319),
FT                   complement(1243874..1244116),complement(1243225..1243790))
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265357"
FT                   /orf_name="AFUA_6G05170"
FT                   /product="Mitochondrial folate carrier protein Flx1,
FT                   putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL85522.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000F51CD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL6"
FT                   /transl_table=1
FT                   /translation="MTIKDGLSSSFVETIAGFTAGIVSTLCLHPLDLLKTRLQVDRSSP
FT                   SQLGGSLRVIREISRREGGITAFYRGLTPNIIGNSTSWALYFLCYGKTKDLMRRLRGSR
FT                   VLELTSADYFVASGLAGLATSFLTNPIWVIKTRMLSTGSNAPGAYASFTTGVTQIYRSE
FT                   GISGFYRGLLPALFGVSHGALQFMAYEKLKAYRTRMSSASRTSGDSIGLGATPARQLGN
FT                   IDFFLTSSLSKIFAGCVTYPYQVLRSRLQTYDAHLVYRGVRDAMAQIWAQEGFGGFYKG
FT                   LGPNLLRVLPSTWVTFLVYENTKSCLT"
     MTIKDGLSSS FVETIAGFTA GIVSTLCLHP LDLLKTRLQV DRSSPSQLGG SLRVIREISR        60
     REGGITAFYR GLTPNIIGNS TSWALYFLCY GKTKDLMRRL RGSRVLELTS ADYFVASGLA       120
     GLATSFLTNP IWVIKTRMLS TGSNAPGAYA SFTTGVTQIY RSEGISGFYR GLLPALFGVS       180
     HGALQFMAYE KLKAYRTRMS SASRTSGDSI GLGATPARQL GNIDFFLTSS LSKIFAGCVT       240
     YPYQVLRSRL QTYDAHLVYR GVRDAMAQIW AQEGFGGFYK GLGPNLLRVL PSTWVTFLVY       300
     ENTKSCLT                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page