(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE401

ASFUM1_6.PE401       Location/Qualifiers
FT   CDS             join(complement(1245315..1245341),
FT                   complement(1245198..1245244),complement(1245105..1245133),
FT                   complement(1245010..1245046),complement(1244932..1244953))
FT                   /codon_start=1
FT                   /gene_family="HOG000200536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265358"
FT                   /orf_name="AFUA_6G05174"
FT                   /product="TOM complex component Tom7, putative "
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="EBA27234.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="HOGENOM:HBG325118"
FT                   /db_xref="InterPro:IPR012621"
FT                   /db_xref="UniParc:UPI0000EA8398"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA16"
FT                   /transl_table=1
FT                   /translation="MVQFSEETKERISKVIDVSRVAIHYGYLPLIIYLGYTYSEPRPSL
FT                   FKLFSPLA"
     MVQFSEETKE RISKVIDVSR VAIHYGYLPL IIYLGYTYSE PRPSLFKLFS PLA               53
//

If you have problems or comments...

PBIL Back to PBIL home page