(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE403

ASFUM1_6.PE403       Location/Qualifiers
FT   CDS             join(complement(1247990..1248044),
FT                   complement(1247611..1247930))
FT                   /codon_start=1
FT                   /gene_family="HOG000200514" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265359"
FT                   /orf_name="AFUA_6G05190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85520.1"
FT                   /db_xref="HOGENOM:HBG056707"
FT                   /db_xref="HOGENOM:HBG398785"
FT                   /db_xref="InterPro:IPR018559"
FT                   /db_xref="UniParc:UPI000051E827"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL8"
FT                   /transl_table=1
FT                   /translation="MAYYTLYFLTFAVVICGTALYLTRSRWLPLIPVPDHLYARLPSSF
FT                   AGDLEAGLSSSQFDISSNIADGDTRAGLDNKAKREVQKIMKTQNVNFDEARRIYTERRF
FT                   ATHNIGPDGRPRDPKFVSFS"
     MAYYTLYFLT FAVVICGTAL YLTRSRWLPL IPVPDHLYAR LPSSFAGDLE AGLSSSQFDI        60
     SSNIADGDTR AGLDNKAKRE VQKIMKTQNV NFDEARRIYT ERRFATHNIG PDGRPRDPKF       120
     VSFS                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page