(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE41

ASFUM1_6.PE41        Location/Qualifiers
FT   CDS             join(complement(133495..133762),complement(133238..133324),
FT                   complement(130789..131499),complement(130400..130711),
FT                   complement(130204..130349))
FT                   /codon_start=1
FT                   /gene_family="HOG000048656" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262220"
FT                   /orf_name="AFUA_6G00530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84212.1"
FT                   /db_xref="HOGENOM:HBG056260"
FT                   /db_xref="UniParc:UPI0000520531"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W907"
FT                   /transl_table=1
FT                   /translation="MIQLSDEPLPTRTECDDDLANRITYLLGRVINRCLLCDAVPLDQC
FT                   EWNGLRDQLEDWRTSLPSSFDPILTPDLLPNSAFPGMWTTSGWHGHHATIVCALALSSR
FT                   SAPVWVNSFGPIAFSHTSINRQYYKNPVFQHYFLARDIHPTTSTTPTTTTTTTTTTTTT
FT                   NNMTIRHVSFNDMTLEDMLINDLLNSNIILRNKIADDLTSLDIAIEDTAINDFADSSID
FT                   VKSIVIDELSTMNMILTELASTIRPLKKWSGMTSSAATSSTATSTSPAWSLITPTETPP
FT                   SENDEEDPDWPFVARKGTLPPSPPLRQRVPTPDEVTEEFLSHTLYPLFGLSRHPNPRGV
FT                   WTLEQNEKAPIPISLDKKDPQLLDHETSCKRIRAILNHCYVEELGYRKQNPAKRSSAVL
FT                   SIPRCGGFEQEVESLGVRFPIEGKLDFVVNNATEPGNGIGVVICVNLCPSANLWQCISF
FT                   MALCHNVRKIENKRLTSVYGVATNGKEFYFLEIDDNDMVRHRFPAHQHE"
     MIQLSDEPLP TRTECDDDLA NRITYLLGRV INRCLLCDAV PLDQCEWNGL RDQLEDWRTS        60
     LPSSFDPILT PDLLPNSAFP GMWTTSGWHG HHATIVCALA LSSRSAPVWV NSFGPIAFSH       120
     TSINRQYYKN PVFQHYFLAR DIHPTTSTTP TTTTTTTTTT TTTNNMTIRH VSFNDMTLED       180
     MLINDLLNSN IILRNKIADD LTSLDIAIED TAINDFADSS IDVKSIVIDE LSTMNMILTE       240
     LASTIRPLKK WSGMTSSAAT SSTATSTSPA WSLITPTETP PSENDEEDPD WPFVARKGTL       300
     PPSPPLRQRV PTPDEVTEEF LSHTLYPLFG LSRHPNPRGV WTLEQNEKAP IPISLDKKDP       360
     QLLDHETSCK RIRAILNHCY VEELGYRKQN PAKRSSAVLS IPRCGGFEQE VESLGVRFPI       420
     EGKLDFVVNN ATEPGNGIGV VICVNLCPSA NLWQCISFMA LCHNVRKIEN KRLTSVYGVA       480
     TNGKEFYFLE IDDNDMVRHR FPAHQHE                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page