(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE414

ASFUM1_6.PE414       Location/Qualifiers
FT   CDS             join(1272227..1272405,1272464..1272635,1272847..1273221)
FT                   /codon_start=1
FT                   /gene_family="HOG000200415" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903390"
FT                   /orf_name="AFUA_6G05310"
FT                   /product="Nucleolus protein required for cell viability,
FT                   putative"
FT                   /protein_id="EAL85508.1"
FT                   /db_xref="HOGENOM:HBG059610"
FT                   /db_xref="InterPro:IPR014810"
FT                   /db_xref="UniParc:UPI000051F66A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN0"
FT                   /transl_table=1
FT                   /translation="MQVEACGKVALHSIEEGALNDHDIEQLLYEAESRLQTCKVQPIST
FT                   SQDQAIGHSGKPFLNIPKLATDSSLQSYIAQRDDVALADTKRIIDPLQMNLSNKRLATV
FT                   KIQQASVNSSTQKEKPTAGADWFHLPKTELTTELKRDLQLIRMRSVLDPKRHYKKESGK
FT                   AQPPKYSQLGTIIEGPTEFFSGRIAKKDRKKTFVEDVLALERETKRFASKYREIQISKQ
FT                   SGKRSFYSNLRAKRNRQKK"
     MQVEACGKVA LHSIEEGALN DHDIEQLLYE AESRLQTCKV QPISTSQDQA IGHSGKPFLN        60
     IPKLATDSSL QSYIAQRDDV ALADTKRIID PLQMNLSNKR LATVKIQQAS VNSSTQKEKP       120
     TAGADWFHLP KTELTTELKR DLQLIRMRSV LDPKRHYKKE SGKAQPPKYS QLGTIIEGPT       180
     EFFSGRIAKK DRKKTFVEDV LALERETKRF ASKYREIQIS KQSGKRSFYS NLRAKRNRQK       240
     K                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page