(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE420

ASFUM1_6.PE420       Location/Qualifiers
FT   CDS             1335190..1336404
FT                   /codon_start=1
FT                   /gene_family="HOG000181631" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207961"
FT                   /orf_name="AFUA_6G06328"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27349.1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="UniParc:UPI0000F51965"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Q0"
FT                   /transl_table=1
FT                   /translation="MRSFFKRPSWASKGDEPVTSDFYRRAGQVYDDIITTNREAREKSV
FT                   CANKPAAEDGRARKRRHLLDDGSLEGSTSLGLDNSFKHNSLSKSRQRCAPSMLTPSSCN
FT                   TLADESMDSGLQKPATTYSGGLAISRNVHQDRDSEFTLLTSDQRCKMNIDDSSQSKMER
FT                   NSKSINDNERLHHQTQARCQKKATDASIRQCSGPRSEDVTVQILITSPIEGTKPLIIHR
FT                   KMSQSLRDVRLAWCKRQDLSPALQASIYLTWKGRRLFDVTTCRSLGLNTSETPTGDEDI
FT                   DKFSQIDGEPLRIHMEAVTDKLAAPDTHQLLPVLGSQSNLNEGSDQKHLMRLVYKCPGF
FT                   DKFETKVASNAPVSQAIAAFRLAKRIPSERKIHLVFDGDCLDPNACFTDYDITDDDLVD
FT                   VLIKY"
     MRSFFKRPSW ASKGDEPVTS DFYRRAGQVY DDIITTNREA REKSVCANKP AAEDGRARKR        60
     RHLLDDGSLE GSTSLGLDNS FKHNSLSKSR QRCAPSMLTP SSCNTLADES MDSGLQKPAT       120
     TYSGGLAISR NVHQDRDSEF TLLTSDQRCK MNIDDSSQSK MERNSKSIND NERLHHQTQA       180
     RCQKKATDAS IRQCSGPRSE DVTVQILITS PIEGTKPLII HRKMSQSLRD VRLAWCKRQD       240
     LSPALQASIY LTWKGRRLFD VTTCRSLGLN TSETPTGDED IDKFSQIDGE PLRIHMEAVT       300
     DKLAAPDTHQ LLPVLGSQSN LNEGSDQKHL MRLVYKCPGF DKFETKVASN APVSQAIAAF       360
     RLAKRIPSER KIHLVFDGDC LDPNACFTDY DITDDDLVDV LIKY                        404
//

If you have problems or comments...

PBIL Back to PBIL home page