(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE421

ASFUM1_6.PE421       Location/Qualifiers
FT   CDS             join(1336683..1336868,1336922..1337152)
FT                   /codon_start=1
FT                   /gene_family="HOG000181652" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207962"
FT                   /orf_name="AFUA_6G06330"
FT                   /product="AdoMet-dependent tRNA methyltransferase (MTase)
FT                   complex subunit Trm112, putative"
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL88485.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG011422"
FT                   /db_xref="HOGENOM:HBG526194"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniParc:UPI0000520183"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH9"
FT                   /transl_table=1
FT                   /translation="MKLVTANFLTCAVKGCKTSSASFPLHFQDAELELEELDFQPEFIR
FT                   NIIPRVDWDGLRVTANELGFSNLPEKKPEGEALNDEQTLKDLHRLLLETHVIEGKLVCG
FT                   NCGHEYLIKEGIANFLLPSHLGLGLPDRIYIVAC"
     MKLVTANFLT CAVKGCKTSS ASFPLHFQDA ELELEELDFQ PEFIRNIIPR VDWDGLRVTA        60
     NELGFSNLPE KKPEGEALND EQTLKDLHRL LLETHVIEGK LVCGNCGHEY LIKEGIANFL       120
     LPSHLGLGLP DRIYIVAC                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page