(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE427

ASFUM1_6.PE427       Location/Qualifiers
FT   CDS             join(1367479..1367745,1367816..1367924,1367975..1368878,
FT                   1368939..1369026)
FT                   /codon_start=1
FT                   /gene_family="HOG000021113" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056667"
FT                   /orf_name="AFUA_6G06370"
FT                   /product="NAD(+)-isocitrate dehydrogenase subunit I "
FT                   /EC_number="1.1.1.41"
FT                   /function="NAD or NADH binding"
FT                   /function="isocitrate dehydrogenase (NAD+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="EAL88491.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004449"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG435977"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI000051FAC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH3"
FT                   /transl_table=1
FT                   /translation="MFSLRTAQPAQVSKTLHQIDCVTRGRAFSHFLSHFSLLRPAAASQ
FT                   QLSHSQCLDVMFLCIKANVLLLCRLSYAAQLVQALSSTPRSQQDLLLACSLTSSSPRSM
FT                   AESTPLLSFQVPMAHPKPCPECDGIGAEVAESVKTIFKADNVPIEWEQVDVSGVDTGNK
FT                   HSEELFKESIASLRRNKLGLKGILFTPVERSGHQSFNVALRQELDIFASIVLIKNIPGY
FT                   KTRHENVDLCIIRENTEGEYSGLEHQSVQGVVESLKIITRAKSERIAKFAFGFALANNR
FT                   KKVTCIHKANIMKLADGLFRSTFHKVAEMYPTLEVNDMIVDNASMQAVSRPQQFDVMVM
FT                   PNLYGGILSNVGAALVGGPGVVPGCNMGRDVAVFEPGCRHVGLDIKGKDQANPSAMILS
FT                   GSMLLRHLGLDDHANRISKAVYDVIGEGKTRTRDMGGQATTHEFTRAVLDKMEAAL"
     MFSLRTAQPA QVSKTLHQID CVTRGRAFSH FLSHFSLLRP AAASQQLSHS QCLDVMFLCI        60
     KANVLLLCRL SYAAQLVQAL SSTPRSQQDL LLACSLTSSS PRSMAESTPL LSFQVPMAHP       120
     KPCPECDGIG AEVAESVKTI FKADNVPIEW EQVDVSGVDT GNKHSEELFK ESIASLRRNK       180
     LGLKGILFTP VERSGHQSFN VALRQELDIF ASIVLIKNIP GYKTRHENVD LCIIRENTEG       240
     EYSGLEHQSV QGVVESLKII TRAKSERIAK FAFGFALANN RKKVTCIHKA NIMKLADGLF       300
     RSTFHKVAEM YPTLEVNDMI VDNASMQAVS RPQQFDVMVM PNLYGGILSN VGAALVGGPG       360
     VVPGCNMGRD VAVFEPGCRH VGLDIKGKDQ ANPSAMILSG SMLLRHLGLD DHANRISKAV       420
     YDVIGEGKTR TRDMGGQATT HEFTRAVLDK MEAAL                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page