(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE433

ASFUM1_6.PE433       Location/Qualifiers
FT   CDS             join(1385399..1385477,1385551..1386173,1386228..1386284)
FT                   /codon_start=1
FT                   /gene_family="HOG000181708" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265370"
FT                   /gene_name="pno1"
FT                   /orf_name="AFUA_6G06430"
FT                   /product="Pre-rRNA-processing protein pno1 "
FT                   /function="RNA binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EAL88497.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG014182"
FT                   /db_xref="HOGENOM:HBG380350"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniParc:UPI0000520184"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNG7"
FT                   /transl_table=1
FT                   /translation="MPAPTALLRKSDEPLSAEEPSLTFSSDAQASGQGEAPSPIPTESA
FT                   QHSDMRIDEESRPVFTPITDAGTVLRVETRKVPVPPHRMTPLKANWPKIYPPLVEHLKL
FT                   QVRMNIKNRAVELRTSKFTTDTGALQKGEDFVKAFTLGFDVDDAIALLRLDDLYIRSFE
FT                   IRDVKASLNGEHLSRAIGRIAGKDGKTKFAIENASRTRVVLQGTKVTILGRFRDLGIAQ
FT                   EAIVSLILGSPPGKVYGNLRKVASRMKERF"
     MPAPTALLRK SDEPLSAEEP SLTFSSDAQA SGQGEAPSPI PTESAQHSDM RIDEESRPVF        60
     TPITDAGTVL RVETRKVPVP PHRMTPLKAN WPKIYPPLVE HLKLQVRMNI KNRAVELRTS       120
     KFTTDTGALQ KGEDFVKAFT LGFDVDDAIA LLRLDDLYIR SFEIRDVKAS LNGEHLSRAI       180
     GRIAGKDGKT KFAIENASRT RVVLQGTKVT ILGRFRDLGI AQEAIVSLIL GSPPGKVYGN       240
     LRKVASRMKE RF                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page