(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE436

ASFUM1_6.PE436       Location/Qualifiers
FT   CDS             join(complement(1391307..1391321),
FT                   complement(1390406..1391170))
FT                   /codon_start=1
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056668"
FT                   /orf_name="AFUA_6G06460"
FT                   /product="Fumarylacetoacetate hydrolase family protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL88500.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG419601"
FT                   /db_xref="HOGENOM:HBG729228"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI000051F5AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG4"
FT                   /transl_table=1
FT                   /translation="MSTFSLFKCLSISSLSGQRLIRFLAKDGQVYYGDAILPVGVSDLA
FT                   KVTKAKVIQGDIFGQHYVTDQVSEVQMLLAPLARKDIRTVRCLGLNYEQHARESNLPIP
FT                   KYPVLFYKPVTSIAGPRDDIPISTMAQEGEGLDYECELVIVIGKEAKDVPESRALDYVL
FT                   GYAVGNDVSHRDWQIKRGGGQWGLGKGFDGWAPFGPGIVSSRLIRHPNALHISTRLNGQ
FT                   VVQSSSTRDMIFSVAKVVAFLSQGTTLLPGDLIFTGT"
     MSTFSLFKCL SISSLSGQRL IRFLAKDGQV YYGDAILPVG VSDLAKVTKA KVIQGDIFGQ        60
     HYVTDQVSEV QMLLAPLARK DIRTVRCLGL NYEQHARESN LPIPKYPVLF YKPVTSIAGP       120
     RDDIPISTMA QEGEGLDYEC ELVIVIGKEA KDVPESRALD YVLGYAVGND VSHRDWQIKR       180
     GGGQWGLGKG FDGWAPFGPG IVSSRLIRHP NALHISTRLN GQVVQSSSTR DMIFSVAKVV       240
     AFLSQGTTLL PGDLIFTGT                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page