(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE442

ASFUM1_6.PE442       Location/Qualifiers
FT   CDS             join(complement(1406758..1409237),
FT                   complement(1406092..1406698),complement(1405489..1406031))
FT                   /codon_start=1
FT                   /gene_family="HOG000181767" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903632"
FT                   /orf_name="AFUA_6G06520"
FT                   /product="WW domain protein"
FT                   /protein_id="EAL88506.1"
FT                   /db_xref="HOGENOM:HBG024070"
FT                   /db_xref="HOGENOM:HBG056395"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000051FA97"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNF8"
FT                   /transl_table=1
FT                   /translation="MNPNSIHQGDPEGELFLNSASRPPAESPVVGPLRISKRDTPSPAS
FT                   QGSAPLPYPDDRPRLGQMRSSSGSTGSSPTAGESGRHGSPISSVNNLSSMPAGSSATRP
FT                   SEYPAALRPRDGREPKPATLAERRGNTAPKPLPESPGPDAPDREALFGRKYQRLPASSA
FT                   LSSDGMQREEGIAYPDYQQQYWPPPQPSTPSALSTRVGVSQSLQPPSSTINRISSTASN
FT                   STTRAQRGSPPPPETPIVGPGQQPGSDIEARYAASGIAGTSTLAGLHAQSAAAQRRAEP
FT                   YAGQLPRTQQHQFPTQRPWTPTEQPGSQPHGPPTVYQGAEAVESRSPNPPASSYQPPPP
FT                   QPVATPPHAAAQGQQPPRIPPNALEQDLERMRISSSPPPAYSSVSGSAAPQGYPNEKQR
FT                   LSASMGQPALAASHPATMATPTAAAAAPTVSPQDHPAFANEPRQQSPAGFSPQNGTSAG
FT                   RQPTPVQNAPATSVPGSSTLPPASPPPLPEGWIAHLDPNSGQYYYIHLPTQSTQWEFPK
FT                   GPTPLNLNETPLSPVGSVYSSHPLASPGFSTFGKPLASPGIPLTPGLAPGYESLQSPVV
FT                   TGFSGPPPSSGVDLYKVAPTNGVYFGPYLRYTNMDLERGIWLGSILLVTDAAQPPTIHI
FT                   HQSVDLSPNPRQLKPMSIAVHQRWTFYKYEVDLRMEESGPAKWTYAITSHLGCTRYEFL
FT                   VAGRYETNWRFVATSGNDFSLNVNANERSRLGGIGFMWKDIMQKHIEIGGFHAQLCCGG
FT                   QIYADRMWKEIPSLKQWLAISGKEARKNAPWTAAHEEDVSHAYFHYYTSHFDQPYLRES
FT                   FAQVPYVCQIDDHDIFDGFGSYPEHMQSSNMFKNIGRIGIEMYLLFQHHTTLDILRNVN
FT                   TDIDLFTITGTGWHFVKYLGPAVVVVGADCRSERNSHQVIAGPTYQGIFPKVAMLPPSV
FT                   QHCIWMLSVPIIYPRLETAEHIAHTVATGKRAVTGAYNVLGKVTSSVAGVVGAKDMVGS
FT                   GFDSVKRAVGKSGLMGGILSPFGELDLLDELRDQWTHDSKDLERTYLIRTLQGIAHQKS
FT                   LRMTFLSGAVNVCGAGLVHDPAHPKDHKTMYQIISSAVVNSPPPSYIIKLLHSSHKPLY
FT                   IPANGHRSTPSQPTDTKEDMMEIFQTDVTGQTREYRKLMGRRNYVAIVAYDPEVVNTMY
FT                   GQNMSHGSGKLNLAVDFMVQGDGTYGNVIKYGPVIVPSLEHGK"
     MNPNSIHQGD PEGELFLNSA SRPPAESPVV GPLRISKRDT PSPASQGSAP LPYPDDRPRL        60
     GQMRSSSGST GSSPTAGESG RHGSPISSVN NLSSMPAGSS ATRPSEYPAA LRPRDGREPK       120
     PATLAERRGN TAPKPLPESP GPDAPDREAL FGRKYQRLPA SSALSSDGMQ REEGIAYPDY       180
     QQQYWPPPQP STPSALSTRV GVSQSLQPPS STINRISSTA SNSTTRAQRG SPPPPETPIV       240
     GPGQQPGSDI EARYAASGIA GTSTLAGLHA QSAAAQRRAE PYAGQLPRTQ QHQFPTQRPW       300
     TPTEQPGSQP HGPPTVYQGA EAVESRSPNP PASSYQPPPP QPVATPPHAA AQGQQPPRIP       360
     PNALEQDLER MRISSSPPPA YSSVSGSAAP QGYPNEKQRL SASMGQPALA ASHPATMATP       420
     TAAAAAPTVS PQDHPAFANE PRQQSPAGFS PQNGTSAGRQ PTPVQNAPAT SVPGSSTLPP       480
     ASPPPLPEGW IAHLDPNSGQ YYYIHLPTQS TQWEFPKGPT PLNLNETPLS PVGSVYSSHP       540
     LASPGFSTFG KPLASPGIPL TPGLAPGYES LQSPVVTGFS GPPPSSGVDL YKVAPTNGVY       600
     FGPYLRYTNM DLERGIWLGS ILLVTDAAQP PTIHIHQSVD LSPNPRQLKP MSIAVHQRWT       660
     FYKYEVDLRM EESGPAKWTY AITSHLGCTR YEFLVAGRYE TNWRFVATSG NDFSLNVNAN       720
     ERSRLGGIGF MWKDIMQKHI EIGGFHAQLC CGGQIYADRM WKEIPSLKQW LAISGKEARK       780
     NAPWTAAHEE DVSHAYFHYY TSHFDQPYLR ESFAQVPYVC QIDDHDIFDG FGSYPEHMQS       840
     SNMFKNIGRI GIEMYLLFQH HTTLDILRNV NTDIDLFTIT GTGWHFVKYL GPAVVVVGAD       900
     CRSERNSHQV IAGPTYQGIF PKVAMLPPSV QHCIWMLSVP IIYPRLETAE HIAHTVATGK       960
     RAVTGAYNVL GKVTSSVAGV VGAKDMVGSG FDSVKRAVGK SGLMGGILSP FGELDLLDEL      1020
     RDQWTHDSKD LERTYLIRTL QGIAHQKSLR MTFLSGAVNV CGAGLVHDPA HPKDHKTMYQ      1080
     IISSAVVNSP PPSYIIKLLH SSHKPLYIPA NGHRSTPSQP TDTKEDMMEI FQTDVTGQTR      1140
     EYRKLMGRRN YVAIVAYDPE VVNTMYGQNM SHGSGKLNLA VDFMVQGDGT YGNVIKYGPV      1200
     IVPSLEHGK                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page