(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE443

ASFUM1_6.PE443       Location/Qualifiers
FT   CDS             join(complement(1410833..1411165),
FT                   complement(1410345..1410761))
FT                   /codon_start=1
FT                   /gene_family="HOG000253031" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266367"
FT                   /orf_name="AFUA_6G06530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27350.1"
FT                   /db_xref="UniParc:UPI0000F51A13"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Q1"
FT                   /transl_table=1
FT                   /translation="MENPNLLPGHGAFQQSVHIQSYRSVFLEDGDSLIALRLYHNTFKL
FT                   AARLGFLAVESRRINLPFPCSHHDQRQREVCEWREALWLLWNSPEAQFLARAQESLPLF
FT                   LQEILWQTSLLYHTSLIFSYTSLWPGQCLGPGAAPQEEVRHHAAAIFSIAESVMAQSKE
FT                   NCWRSVTFPVFLAGSVTSSSDLKVIALDMLSRLEVREIGRNATSIRYLFQVVYERQMQQ
FT                   SQGVGHPGSADWMEILAEHGLSLVASA"
     MENPNLLPGH GAFQQSVHIQ SYRSVFLEDG DSLIALRLYH NTFKLAARLG FLAVESRRIN        60
     LPFPCSHHDQ RQREVCEWRE ALWLLWNSPE AQFLARAQES LPLFLQEILW QTSLLYHTSL       120
     IFSYTSLWPG QCLGPGAAPQ EEVRHHAAAI FSIAESVMAQ SKENCWRSVT FPVFLAGSVT       180
     SSSDLKVIAL DMLSRLEVRE IGRNATSIRY LFQVVYERQM QQSQGVGHPG SADWMEILAE       240
     HGLSLVASA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page