(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE444

ASFUM1_6.PE444       Location/Qualifiers
FT   CDS             complement(1411676..1412254)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266368"
FT                   /orf_name="AFUA_6G06535"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27351.1"
FT                   /db_xref="UniParc:UPI0000F51972"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Q2"
FT                   /transl_table=1
FT                   /translation="MHDPLPPFALLVTDEEREGKAETSRPGTYHVIVIPESFTHLPEYI
FT                   ENAAEEELGDTIPSPLCGNIETAQLTNNLGLGDSNVVILRQFKDSKRSSSSQCPSASHS
FT                   PTSDLRESSLSAVTIDATSQNAADDYPILDMLEQESLEAILLSHFRDVVWMQLVPARGI
FT                   FNFAGENALDVDVFDREATNFPPVRFAIP"
     MHDPLPPFAL LVTDEEREGK AETSRPGTYH VIVIPESFTH LPEYIENAAE EELGDTIPSP        60
     LCGNIETAQL TNNLGLGDSN VVILRQFKDS KRSSSSQCPS ASHSPTSDLR ESSLSAVTID       120
     ATSQNAADDY PILDMLEQES LEAILLSHFR DVVWMQLVPA RGIFNFAGEN ALDVDVFDRE       180
     ATNFPPVRFA IP                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page