(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE46

ASFUM1_6.PE46        Location/Qualifiers
FT   CDS             join(complement(142729..143403),complement(142206..142724))
FT                   /codon_start=1
FT                   /gene_family="HOG000161922" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262223"
FT                   /orf_name="AFUA_6G00570"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84208.2"
FT                   /db_xref="HOGENOM:HBG056239"
FT                   /db_xref="UniParc:UPI0000F51883"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W911"
FT                   /transl_table=1
FT                   /translation="MAGNAIAFLLTALTAVPLANDLFPQSRGSSTVVRVAAGLSLPRDG
FT                   DYARTGGNTPSIALFDESGERIGFKSGARHGKIGDGKFKDIVVEPINKDNSRAPAYLSV
FT                   PSSGNDALCIADIYITPPSKEFWAFFGDVPKECGVAWYRSNLPVQRQNGDPFKPRCFWI
FT                   DSPDTGKTTSSFPQGAGIHLTDFTANQGRVQQYQISRDTMCASAPRFSLYSSLTEMNCL
FT                   PIFPPLTYNEDGTDTSFAALKTPGQVMCSPGPNEKPTAKQILQLQKWTGGRVSTPTYGV
FT                   KTRSVKARQNDRVCFADHQVVVVSEHREHTASELCKSTSAAGPDFVSTKEGLFCDMCTG
FT                   ELWPLCSKNVPTGCFDVDLKVMRASDGAVTRTGLHARDVITGRDIPEKEYKKVAHWK"
     MAGNAIAFLL TALTAVPLAN DLFPQSRGSS TVVRVAAGLS LPRDGDYART GGNTPSIALF        60
     DESGERIGFK SGARHGKIGD GKFKDIVVEP INKDNSRAPA YLSVPSSGND ALCIADIYIT       120
     PPSKEFWAFF GDVPKECGVA WYRSNLPVQR QNGDPFKPRC FWIDSPDTGK TTSSFPQGAG       180
     IHLTDFTANQ GRVQQYQISR DTMCASAPRF SLYSSLTEMN CLPIFPPLTY NEDGTDTSFA       240
     ALKTPGQVMC SPGPNEKPTA KQILQLQKWT GGRVSTPTYG VKTRSVKARQ NDRVCFADHQ       300
     VVVVSEHREH TASELCKSTS AAGPDFVSTK EGLFCDMCTG ELWPLCSKNV PTGCFDVDLK       360
     VMRASDGAVT RTGLHARDVI TGRDIPEKEY KKVAHWK                                397
//

If you have problems or comments...

PBIL Back to PBIL home page