(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE48

ASFUM1_6.PE48        Location/Qualifiers
FT   CDS             149233..149496
FT                   /codon_start=1
FT                   /gene_family="HOG000217785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262224"
FT                   /orf_name="AFUA_6G00590"
FT                   /product="Secreted peptide, putative "
FT                   /protein_id="EBA27168.1"
FT                   /db_xref="UniParc:UPI0000F51880"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA93"
FT                   /transl_table=1
FT                   /translation="MKFSIIALTFIGSALAAPGASIPTPSTPAAPSCAASSSHIASSTA
FT                   SPSASPIFQPGCDIEHVGNNGKHLGWCKKARHYGMYNNGTSI"
     MKFSIIALTF IGSALAAPGA SIPTPSTPAA PSCAASSSHI ASSTASPSAS PIFQPGCDIE        60
     HVGNNGKHLG WCKKARHYGM YNNGTSI                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page