(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE49

ASFUM1_6.PE49        Location/Qualifiers
FT   CDS             join(complement(150897..151038),complement(150490..150842))
FT                   /codon_start=1
FT                   /gene_family="HOG000202745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750574"
FT                   /orf_name="AFUA_6G00600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84206.1"
FT                   /db_xref="HOGENOM:HBG056225"
FT                   /db_xref="UniParc:UPI000051F9AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W913"
FT                   /transl_table=1
FT                   /translation="MLRNTVIRSVQLSRNMSSFTQPTPIVACGRSTATGKLVSQHLLPE
FT                   YEVIHFIQSVEAAEAELPHLLAGRDPQSRYSNELGTHDYSRPPRAVIFGRGYEPQQVEE
FT                   LKEKFAGVAKEPVAWVRGNPADVPAGGPGPDYAQKVAADMKQVLKKWRDAGAKDEETLV
FT                   Y"
     MLRNTVIRSV QLSRNMSSFT QPTPIVACGR STATGKLVSQ HLLPEYEVIH FIQSVEAAEA        60
     ELPHLLAGRD PQSRYSNELG THDYSRPPRA VIFGRGYEPQ QVEELKEKFA GVAKEPVAWV       120
     RGNPADVPAG GPGPDYAQKV AADMKQVLKK WRDAGAKDEE TLVY                        164
//

If you have problems or comments...

PBIL Back to PBIL home page