(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE5

ASFUM1_6.PE5         Location/Qualifiers
FT   CDS             join(49283..49595,49676..51363)
FT                   /codon_start=1
FT                   /gene_family="HOG000217780" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262205"
FT                   /orf_name="AFUA_6G00160"
FT                   /product="Ser/Thr protein phosphatase family protein "
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="EAL84250.1"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG056538"
FT                   /db_xref="HOGENOM:HBG326797"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="UniParc:UPI000051EFE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8W9"
FT                   /transl_table=1
FT                   /translation="MMRSHTALSIAALLALARVPCTVFGDNIIYPQQQKEAFNATEIPR
FT                   APLPWGRVNFLHTTDTHGWLDGHANVPSWGADWGDFVSFVMHMKDKALRKKVDLLLIES
FT                   GDFHDGGGLSDSTSPKGAVSDSIFENIDYDLVTIGNHGVRTWAEALNIHYNLSRVFGDR
FT                   FLTSNVDVEEDKKLKSIGNRYRAFQTRNGLRIVAFGVTVNDPILRDLNHTEVHNASWIF
FT                   EQEWFAEAMKKEADLYVIVGHIPTYASCLDPTKDNPMVCLRDRIRNSTDKPIQLFGGHA
FT                   HHRNFTCYDDRSSGIESGKYCDTVGWVALNNVLSPTWSGTKELLGDDLHPNKSCAVGRQ
FT                   GDTHDAPYLLDRRYLDWNRVTFAYHTVNLEGNTDNPSVPASFDMPLGRKVTDDISKARQ
FT                   LLNLTHFLGCAKEEYCFNCKKVGQDGNIYELLKVALADTVVNKERAHLARVVISNDGTI
FT                   RDNIYQGPFTTGDAYAVVPFPNHFLYIANMPCHHFKKMTSSLQAKQNVSCIDDDDYDEP
FT                   YVIKKEGHRSQYQAHLELRNIFDYHSDHQARERKEYSPGYTTHDALGNDGDDTLHSPVI
FT                   EDERYMKLFWANASFPNLPQYPPSFDVVFTDYLAPRILGALKRIGAPYTQKDVIDYLPR
FT                   TYTSRDVLVDYTARNWDQDRDNCHIQKPGDR"
     MMRSHTALSI AALLALARVP CTVFGDNIIY PQQQKEAFNA TEIPRAPLPW GRVNFLHTTD        60
     THGWLDGHAN VPSWGADWGD FVSFVMHMKD KALRKKVDLL LIESGDFHDG GGLSDSTSPK       120
     GAVSDSIFEN IDYDLVTIGN HGVRTWAEAL NIHYNLSRVF GDRFLTSNVD VEEDKKLKSI       180
     GNRYRAFQTR NGLRIVAFGV TVNDPILRDL NHTEVHNASW IFEQEWFAEA MKKEADLYVI       240
     VGHIPTYASC LDPTKDNPMV CLRDRIRNST DKPIQLFGGH AHHRNFTCYD DRSSGIESGK       300
     YCDTVGWVAL NNVLSPTWSG TKELLGDDLH PNKSCAVGRQ GDTHDAPYLL DRRYLDWNRV       360
     TFAYHTVNLE GNTDNPSVPA SFDMPLGRKV TDDISKARQL LNLTHFLGCA KEEYCFNCKK       420
     VGQDGNIYEL LKVALADTVV NKERAHLARV VISNDGTIRD NIYQGPFTTG DAYAVVPFPN       480
     HFLYIANMPC HHFKKMTSSL QAKQNVSCID DDDYDEPYVI KKEGHRSQYQ AHLELRNIFD       540
     YHSDHQARER KEYSPGYTTH DALGNDGDDT LHSPVIEDER YMKLFWANAS FPNLPQYPPS       600
     FDVVFTDYLA PRILGALKRI GAPYTQKDVI DYLPRTYTSR DVLVDYTARN WDQDRDNCHI       660
     QKPGDR                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page