(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE56

ASFUM1_6.PE56        Location/Qualifiers
FT   CDS             join(172246..172587,172630..172665,172720..172788,
FT                   172834..173376)
FT                   /codon_start=1
FT                   /gene_family="HOG000202790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055872"
FT                   /orf_name="AFUA_6G00670"
FT                   /product="Extracellular serine-rich protein "
FT                   /protein_id="EAL84199.2"
FT                   /db_xref="HOGENOM:HBG056180"
FT                   /db_xref="HOGENOM:HBG325025"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniParc:UPI0000F5187D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W920"
FT                   /transl_table=1
FT                   /translation="MLKLSIMSMTVLLFFQSRTTHATGAVPTAMTPSSTAPHATHTVKV
FT                   GPKENPHQYSPHNITAAVGDVIVFEFYPRNHSVVKADFMAPCVPAAGEIFYSGQFNTFK
FT                   ENNHGQLEGEPPTWSLVVNDTEPTFFYCTAVDSCLFNGMVGVINPNETMTWEAQYAQAQ
FT                   QYPYMLVPGQSPPAEGTGYLSSGSNAHKKSSFGGGAIAGTVVGGVAFVAILVVVAITLC
FT                   RNRERQGSSSQVGRMERTAHWARFGGHGEEKSEQGFAASSSVGGHGTLSLSSGASPPAV
FT                   SPPLQNVGSSNWESAMKQQPPQEIRQPSELEATNVVGGTPGGMYYGWR"
     MLKLSIMSMT VLLFFQSRTT HATGAVPTAM TPSSTAPHAT HTVKVGPKEN PHQYSPHNIT        60
     AAVGDVIVFE FYPRNHSVVK ADFMAPCVPA AGEIFYSGQF NTFKENNHGQ LEGEPPTWSL       120
     VVNDTEPTFF YCTAVDSCLF NGMVGVINPN ETMTWEAQYA QAQQYPYMLV PGQSPPAEGT       180
     GYLSSGSNAH KKSSFGGGAI AGTVVGGVAF VAILVVVAIT LCRNRERQGS SSQVGRMERT       240
     AHWARFGGHG EEKSEQGFAA SSSVGGHGTL SLSSGASPPA VSPPLQNVGS SNWESAMKQQ       300
     PPQEIRQPSE LEATNVVGGT PGGMYYGWR                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page