(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE58

ASFUM1_6.PE58        Location/Qualifiers
FT   CDS             175566..176207
FT                   /codon_start=1
FT                   /gene_family="HOG000202812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750575"
FT                   /orf_name="AFUA_6G00690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84197.1"
FT                   /db_xref="HOGENOM:HBG056077"
FT                   /db_xref="UniParc:UPI000051EFE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W922"
FT                   /transl_table=1
FT                   /translation="MHLLSKAAVLLLALNVSARPIEEPPAQTTAPAGYGDYKDYGSYGK
FT                   YGDYGHYKRDEEPSPTTTCTETETPTPANYGDYGDYGNYGQYGDYGHYKRGEEPTTTTT
FT                   TTTETPSPSPANYGNYGQYGDYGHYKRDEEPTATTTETPTPSPTPADYGNYGDYGNYGK
FT                   YGDYGQYKVKRDDEPRTTTTETPTPSPTPADYGDYGNYGNYGNYGTYENY"
     MHLLSKAAVL LLALNVSARP IEEPPAQTTA PAGYGDYKDY GSYGKYGDYG HYKRDEEPSP        60
     TTTCTETETP TPANYGDYGD YGNYGQYGDY GHYKRGEEPT TTTTTTTETP SPSPANYGNY       120
     GQYGDYGHYK RDEEPTATTT ETPTPSPTPA DYGNYGDYGN YGKYGDYGQY KVKRDDEPRT       180
     TTTETPTPSP TPADYGDYGN YGNYGNYGTY ENY                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page