(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE6

ASFUM1_6.PE6         Location/Qualifiers
FT   CDS             join(complement(55906..56057),complement(53457..53545),
FT                   complement(53313..53401))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207153"
FT                   /orf_name="AFUA_6G00180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84249.1"
FT                   /db_xref="HOGENOM:HBG056529"
FT                   /db_xref="UniParc:UPI000051ED58"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X0"
FT                   /transl_table=1
FT                   /translation="MAGYKVNCKNGYSLEVGADGGQAWYGTPHGNFRWTQGYDRSDNFI
FT                   VWDNWRGIMNFMLAFVTPIAMVPNYEKRVRMIFQSGSSAEGGSGCCNHSVDVFSASNLK
FT                   VRSNC"
     MAGYKVNCKN GYSLEVGADG GQAWYGTPHG NFRWTQGYDR SDNFIVWDNW RGIMNFMLAF        60
     VTPIAMVPNY EKRVRMIFQS GSSAEGGSGC CNHSVDVFSA SNLKVRSNC                   109
//

If you have problems or comments...

PBIL Back to PBIL home page