(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE60

ASFUM1_6.PE60        Location/Qualifiers
FT   CDS             join(complement(181888..181926),complement(181629..181832))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902581"
FT                   /orf_name="AFUA_6G00720"
FT                   /product="LysM domain protein, putative "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="EAL84194.2"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="HOGENOM:HBG056653"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI0000F5187B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W925"
FT                   /transl_table=1
FT                   /translation="MTTECTNLGLDYYPTSSGLEPQMPGIVSNYAKFYQVKSGDSCWSI
FT                   ENAAGITLAQFRSWNTQIDESCTNLWVDYYVCIGV"
     MTTECTNLGL DYYPTSSGLE PQMPGIVSNY AKFYQVKSGD SCWSIENAAG ITLAQFRSWN        60
     TQIDESCTNL WVDYYVCIGV                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page