(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE61

ASFUM1_6.PE61        Location/Qualifiers
FT   CDS             join(complement(183676..183912),complement(182792..183121))
FT                   /codon_start=1
FT                   /gene_family="HOG000048654" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055873"
FT                   /orf_name="AFUA_6G00730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84193.1"
FT                   /db_xref="HOGENOM:HBG056578"
FT                   /db_xref="UniParc:UPI000051EB24"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W926"
FT                   /transl_table=1
FT                   /translation="MVVFRYDVVVVVVVVLLLRFPLLLSLGVRRPWDGGRAGGLEGNAN
FT                   ADIQRAFIYSHRRHIGPSDSSGISGPKTHDSARGHHPSQTPKLPDRISNDINNVLNTDV
FT                   EVNVAVCPLGLNPKGTRAKLHRLVLTADRLLNLPFAISIRIFFTTCMQSDTLEDASLVW
FT                   STTSQVSAAVGRLVRDAWVIDHVGV"
     MVVFRYDVVV VVVVVLLLRF PLLLSLGVRR PWDGGRAGGL EGNANADIQR AFIYSHRRHI        60
     GPSDSSGISG PKTHDSARGH HPSQTPKLPD RISNDINNVL NTDVEVNVAV CPLGLNPKGT       120
     RAKLHRLVLT ADRLLNLPFA ISIRIFFTTC MQSDTLEDAS LVWSTTSQVS AAVGRLVRDA       180
     WVIDHVGV                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page