(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE66

ASFUM1_6.PE66        Location/Qualifiers
FT   CDS             join(244292..244792,244860..245249,245300..245407)
FT                   /codon_start=1
FT                   /gene_family="HOG000202723" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262230"
FT                   /orf_name="AFUA_6G01790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85860.1"
FT                   /db_xref="HOGENOM:HBG056383"
FT                   /db_xref="HOGENOM:HBG510404"
FT                   /db_xref="UniParc:UPI000051EA6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM8"
FT                   /transl_table=1
FT                   /translation="MPLTEEQKQHWLEHGFIKIPQCFTKQDADNWTASIWARLGISPTD
FT                   KSTWNTERVNMPGHTVVDVKDFAPKAWDAICELVGGEERVTDWCKGWRDSWIINLGKPE
FT                   YKPDDPLDFRTLDNWHNDGDFFTHFLDSGEQALLVIPLFSDIRSKGGGTVLCTDGIGLV
FT                   AKHLYNHPEGTWPSLASRSGPNPPPPEGGKQWRDWVRDPQLTRAESFHEATGQAGDVYL
FT                   LHPFMLHSASRNLLREVRIITNPPVSLKEPFNYNRPDGKYSLVEQKTLKELGRPEGLPE
FT                   WRITGEREMLTPARVQIQEDMRQKELERLKEVGAPVTKLGTAKPLQSQYPA"
     MPLTEEQKQH WLEHGFIKIP QCFTKQDADN WTASIWARLG ISPTDKSTWN TERVNMPGHT        60
     VVDVKDFAPK AWDAICELVG GEERVTDWCK GWRDSWIINL GKPEYKPDDP LDFRTLDNWH       120
     NDGDFFTHFL DSGEQALLVI PLFSDIRSKG GGTVLCTDGI GLVAKHLYNH PEGTWPSLAS       180
     RSGPNPPPPE GGKQWRDWVR DPQLTRAESF HEATGQAGDV YLLHPFMLHS ASRNLLREVR       240
     IITNPPVSLK EPFNYNRPDG KYSLVEQKTL KELGRPEGLP EWRITGEREM LTPARVQIQE       300
     DMRQKELERL KEVGAPVTKL GTAKPLQSQY PA                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page