(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE7

ASFUM1_6.PE7         Location/Qualifiers
FT   CDS             complement(57953..58330)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055868"
FT                   /orf_name="AFUA_6G00190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84248.1"
FT                   /db_xref="HOGENOM:HBG056521"
FT                   /db_xref="UniParc:UPI0000520791"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X1"
FT                   /transl_table=1
FT                   /translation="MTYTDTSLVYTSLFVCPEVWSTSSYYYEHGNNSTTSCQNKNLAQA
FT                   IKDLSHNFTYSLLSLNGGNTTVDMTDLTCRNYYSYGSTALLGVYLSALAVMIACVVVGF
FT                   LALRRNGVSYNNSFSGVLLTT"
     MTYTDTSLVY TSLFVCPEVW STSSYYYEHG NNSTTSCQNK NLAQAIKDLS HNFTYSLLSL        60
     NGGNTTVDMT DLTCRNYYSY GSTALLGVYL SALAVMIACV VVGFLALRRN GVSYNNSFSG       120
     VLLTT                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page