(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE71

ASFUM1_6.PE71        Location/Qualifiers
FT   CDS             join(complement(257601..257750),complement(256952..257533),
FT                   complement(256715..256875),complement(256500..256661),
FT                   complement(256097..256447),complement(255434..256019))
FT                   /codon_start=1
FT                   /gene_family="HOG000174895" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207162"
FT                   /orf_name="AFUA_6G01840"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85855.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055982"
FT                   /db_xref="HOGENOM:HBG326933"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051EF18"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN3"
FT                   /transl_table=1
FT                   /translation="MSDSHYQSSSRPLAPAPGRLLKRNASSDELVPARKHKTTACKACK
FT                   RKKLKCRGDPPCQHCVSHGVKCEVEAMSDMRRKNAMDRKVAKLEKVADTLTRLINALRD
FT                   SESRRVSQLLNLIRSNASFDELQLFLEQQFSHYELESTPELRDIQSQLSQTTDLAPLGW
FT                   RYLRVDRLADDPVYKVPAKPWTAVTDDSELVSHLVSLWLTWTYPWFNWLDADCLIKHMQ
FT                   EGKLNSRFCSPFLVNAILAEACYYSDYEEVFTVPGDLLTRGDQFFDEARRLFEAGEDEG
FT                   DSPSLPTIQGLMILFVRTSMMGKDRMGWVYLDLAARGAQEYAASHPPHAMEDAEERRAI
FT                   DRTLWGIFSMASTASVSLMKHFESHPPQQSPITRIIHQRHKDDVWQPYPRSTDAGVPSH
FT                   ISCVFNRWCAIACIAVEISRAIYCEEDRIPRAEMLPFINVIYQKLQDWYADMPECLLVE
FT                   NITVPHALSLHLFYHTTVMQIFGLLKANHEHLDPASIQRARNICIESALRIAGLIGIHR
FT                   DKWGIGRMAPSTIQWLSIGMFTLLDALDSPDTRNRAAFIEMCIVARAFARRFPLAKGIL
FT                   RMIQLSANQMQVVLPAETDALFTDFETRSWEGKDRQTFSTFYPNFARVVRQGAAREEDV
FT                   SMDRFLEKWDSLAISDPKEETPPDEGGS"
     MSDSHYQSSS RPLAPAPGRL LKRNASSDEL VPARKHKTTA CKACKRKKLK CRGDPPCQHC        60
     VSHGVKCEVE AMSDMRRKNA MDRKVAKLEK VADTLTRLIN ALRDSESRRV SQLLNLIRSN       120
     ASFDELQLFL EQQFSHYELE STPELRDIQS QLSQTTDLAP LGWRYLRVDR LADDPVYKVP       180
     AKPWTAVTDD SELVSHLVSL WLTWTYPWFN WLDADCLIKH MQEGKLNSRF CSPFLVNAIL       240
     AEACYYSDYE EVFTVPGDLL TRGDQFFDEA RRLFEAGEDE GDSPSLPTIQ GLMILFVRTS       300
     MMGKDRMGWV YLDLAARGAQ EYAASHPPHA MEDAEERRAI DRTLWGIFSM ASTASVSLMK       360
     HFESHPPQQS PITRIIHQRH KDDVWQPYPR STDAGVPSHI SCVFNRWCAI ACIAVEISRA       420
     IYCEEDRIPR AEMLPFINVI YQKLQDWYAD MPECLLVENI TVPHALSLHL FYHTTVMQIF       480
     GLLKANHEHL DPASIQRARN ICIESALRIA GLIGIHRDKW GIGRMAPSTI QWLSIGMFTL       540
     LDALDSPDTR NRAAFIEMCI VARAFARRFP LAKGILRMIQ LSANQMQVVL PAETDALFTD       600
     FETRSWEGKD RQTFSTFYPN FARVVRQGAA REEDVSMDRF LEKWDSLAIS DPKEETPPDE       660
     GGS                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page