(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE72

ASFUM1_6.PE72        Location/Qualifiers
FT   CDS             join(259325..259768,260537..261274)
FT                   /codon_start=1
FT                   /gene_family="HOG000048653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902583"
FT                   /orf_name="AFUA_6G01850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85854.1"
FT                   /db_xref="HOGENOM:HBG056380"
FT                   /db_xref="UniParc:UPI000051FB5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN4"
FT                   /transl_table=1
FT                   /translation="MRATTHGQRTEDHDDQDPAKICSLTHVQVWTFRQRRFSGPHVTRP
FT                   DPSILLLQDSKQTFTWLSSTVDYSHMTFLASQRIHRIHVIDHLLLTISPSRTRVCPHQT
FT                   RQQEYPGPNPRQESVFDLIQDIEHDQRDQHVPSSGRSAPPCDGKQPRHPLPEPNCPSTE
FT                   DVRYPQLPSRMRTSPAPQSTNTMRTMRSYDDFTRDADDADTAIADPTATTTDDDDRRKR
FT                   TKTTHAASRICYDWMIVLGNCHYARDRASFTHYRAMPRRTLVKNNIFNPHEELEVAGVG
FT                   TVELRVCRTVRDGGASSHVLVLEDVLHIPEAVCNGFNPLLYGSSMSCNMEYWEGADRRG
FT                   EPVWFAVPYAGGTRLVLAGNPKGASELIQGRYYTLSLSITPQERREIFDAMAC"
     MRATTHGQRT EDHDDQDPAK ICSLTHVQVW TFRQRRFSGP HVTRPDPSIL LLQDSKQTFT        60
     WLSSTVDYSH MTFLASQRIH RIHVIDHLLL TISPSRTRVC PHQTRQQEYP GPNPRQESVF       120
     DLIQDIEHDQ RDQHVPSSGR SAPPCDGKQP RHPLPEPNCP STEDVRYPQL PSRMRTSPAP       180
     QSTNTMRTMR SYDDFTRDAD DADTAIADPT ATTTDDDDRR KRTKTTHAAS RICYDWMIVL       240
     GNCHYARDRA SFTHYRAMPR RTLVKNNIFN PHEELEVAGV GTVELRVCRT VRDGGASSHV       300
     LVLEDVLHIP EAVCNGFNPL LYGSSMSCNM EYWEGADRRG EPVWFAVPYA GGTRLVLAGN       360
     PKGASELIQG RYYTLSLSIT PQERREIFDA MAC                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page