(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE74

ASFUM1_6.PE74        Location/Qualifiers
FT   CDS             join(complement(265716..265856),complement(265215..265657),
FT                   complement(265075..265169),complement(264914..265014),
FT                   complement(264445..264864))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750821"
FT                   /orf_name="AFUA_6G01870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85852.1"
FT                   /db_xref="HOGENOM:HBG056379"
FT                   /db_xref="UniParc:UPI000051F419"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN6"
FT                   /transl_table=1
FT                   /translation="MGDSFTNEAFTLLSLAIVVIILRIVARIMTVGLHNFQLDDYLMPL
FT                   AGVVYGLETGAAYCVGAWWKGLANNHMTDDQRAALSPDSEEFRLRVGGSKTQVLGWSLY
FT                   TTLLWLLKACMAIFYSRLTYVSPRLEVVTDTDTDADTDADADGQGRSDQHAYPRACGLR
FT                   GHRGDLSDCDSVDPVWLPSDAQELADLSKSWPTLPTRHRAARCLHDRHAECRDGYLSHY
FT                   HSHTARLPWREKLELFILFSGGIFVMAAGILRCVLIVTAGANGASQAGSWACRETFVAV
FT                   VIGNAPMIYPLFRRAARRAGWYISSRGHSQSYPAYPLSEGERGENSTHHSKKRRFRHPL
FT                   SIPDTHWHTINDEAMILPTSRQQPPTCTASPPRDWDALSQPSADGIKVVHEMIIERNER
FT                   "
     MGDSFTNEAF TLLSLAIVVI ILRIVARIMT VGLHNFQLDD YLMPLAGVVY GLETGAAYCV        60
     GAWWKGLANN HMTDDQRAAL SPDSEEFRLR VGGSKTQVLG WSLYTTLLWL LKACMAIFYS       120
     RLTYVSPRLE VVTDTDTDAD TDADADGQGR SDQHAYPRAC GLRGHRGDLS DCDSVDPVWL       180
     PSDAQELADL SKSWPTLPTR HRAARCLHDR HAECRDGYLS HYHSHTARLP WREKLELFIL       240
     FSGGIFVMAA GILRCVLIVT AGANGASQAG SWACRETFVA VVIGNAPMIY PLFRRAARRA       300
     GWYISSRGHS QSYPAYPLSE GERGENSTHH SKKRRFRHPL SIPDTHWHTI NDEAMILPTS       360
     RQQPPTCTAS PPRDWDALSQ PSADGIKVVH EMIIERNER                              399
//

If you have problems or comments...

PBIL Back to PBIL home page