(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE8

ASFUM1_6.PE8         Location/Qualifiers
FT   CDS             join(complement(60771..60842),complement(60424..60659),
FT                   complement(59907..60156))
FT                   /codon_start=1
FT                   /gene_family="HOG000048663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902572"
FT                   /orf_name="AFUA_6G00193"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /function="metal ion binding"
FT                   /protein_id="EAL84247.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG056513"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniParc:UPI00005202D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X2"
FT                   /transl_table=1
FT                   /translation="MIYACTFPNCWGRCTLRSSFTATCQTISTSEYCRTRITSIIVWDT
FT                   LSLSALSQIVSKEPRCYFFSQIAEEPCCNTLRTKEQLGYIANSAVVVYVMAGTWRILLP
FT                   CTLTNSIDQISTVYHDVEHIEPFTKKDIHEFPNQDIHPTSPVAQSCLYILLHGHLLELL
FT                   EETELQLKKILTLQCWMKIKTD"
     MIYACTFPNC WGRCTLRSSF TATCQTISTS EYCRTRITSI IVWDTLSLSA LSQIVSKEPR        60
     CYFFSQIAEE PCCNTLRTKE QLGYIANSAV VVYVMAGTWR ILLPCTLTNS IDQISTVYHD       120
     VEHIEPFTKK DIHEFPNQDI HPTSPVAQSC LYILLHGHLL ELLEETELQL KKILTLQCWM       180
     KIKTD                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page