(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE81

ASFUM1_6.PE81        Location/Qualifiers
FT   CDS             join(282872..282999,283061..283159,283219..283289,
FT                   283348..283395,283470..284077)
FT                   /codon_start=1
FT                   /gene_family="HOG000171458" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056120"
FT                   /orf_name="AFUA_6G01940"
FT                   /product="Dienelactone hydrolase family protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85845.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG056373"
FT                   /db_xref="HOGENOM:HBG525846"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI000051EA69"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP3"
FT                   /transl_table=1
FT                   /translation="METQQPRSSSSLLTILLPLYLIIGHGAQLLSSIANRSKRYLCASL
FT                   LGSVKPRSIYAFRPLHCSSVNMSGISKACCSIPPIVAQGYQGKGEYKTINGMKTYVTGP
FT                   DSASKAIFIVYDIFGFFPQTIQGADILATSSEQKYRVFMPDFFEGKPADITWFPPQTEE
FT                   HKQKLGNFFQTKAAPPANLPKIPSFVDEANKLAPNGKAFESWSILGYCWGGKIACLSSA
FT                   KDTKFKAAVQCHPAMVDPNDAKNVTIPMAMLASKDENPKDVEAFGANLKVDHYVETFST
FT                   QIHGWMAARSNLEDEEVRKEYERGYKTALSFLQKHA"
     METQQPRSSS SLLTILLPLY LIIGHGAQLL SSIANRSKRY LCASLLGSVK PRSIYAFRPL        60
     HCSSVNMSGI SKACCSIPPI VAQGYQGKGE YKTINGMKTY VTGPDSASKA IFIVYDIFGF       120
     FPQTIQGADI LATSSEQKYR VFMPDFFEGK PADITWFPPQ TEEHKQKLGN FFQTKAAPPA       180
     NLPKIPSFVD EANKLAPNGK AFESWSILGY CWGGKIACLS SAKDTKFKAA VQCHPAMVDP       240
     NDAKNVTIPM AMLASKDENP KDVEAFGANL KVDHYVETFS TQIHGWMAAR SNLEDEEVRK       300
     EYERGYKTAL SFLQKHA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page