(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE84

ASFUM1_6.PE84        Location/Qualifiers
FT   CDS             join(302648..303075,303159..305376)
FT                   /codon_start=1
FT                   /gene_family="HOG000202599" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207407"
FT                   /orf_name="AFUA_6G01970"
FT                   /product="GATA transcriptional activator AreA "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="transcription activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="nitrate assimilation"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85842.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="GO:0042128"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG056370"
FT                   /db_xref="HOGENOM:HBG327052"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR011420"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniParc:UPI000051FDBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP6"
FT                   /transl_table=1
FT                   /translation="MSGMSHGGAPKAARPTPTAVSASSGYDIADADRSSSSHFHHTSQL
FT                   SDDFSLGSPLSPPDSAHVQDGLLQDSLFPEWRNAAPRDGVESPDEMQRKDPLATQIWKL
FT                   YSRTKAQLPNQERMENLTWRMMAMSLKRKERERLQQNNRPSTKNSGSSEPSGIAQLRQT
FT                   DRPSFARPSTSTDLASDPMNIDDFIVPIESPADRPRSPPTDKAATSSVAIPIKSRKDQS
FT                   ADATPVPASFPHPPQDQRRNNEFGYVPRRVRKTSIDERQFFNLQIPTRKRPAESSPQVP
FT                   PVSNAMLAQDPNFSAGVPDYTLDNASSGFALHSNTQNHHNNNNLTSPGVPFGLDTFSLG
FT                   EDPILSSAGPYQAHFTFSPSDSPMTSANPFANVYAQTPIASSLNSTEFFSPPPSGYQSS
FT                   VSTPQPTYDGDHSMYFDMPSIDARTQRRIPNYITHRSNLSASLQPRFMFNNNTGSEQQH
FT                   GMTHGSNSSSAVHSPNYTMSQSQHVDPTQVLNPSDFPTSNTHAGIFSFGADSDNEDDDA
FT                   NNYTERAGLAMPADFGDDNAGDMNGLNWDGQFPGSFHSLSGFSVQHRKHVTIGSADMMD
FT                   TPSEWNQGGSLGRTHGSAASVSEVRNREQDPRRQKIARTTSTPNTNQLLRQSMNNTSHT
FT                   SPNTPPESGLSSAVPSRPASPGGSKNGDQNNGPTTCTNCFTQTTPLWRRNPEGQPLCNA
FT                   CGLFLKLHGVVRPLSLKTDVIKKRNRSSANSLAVGASRSSKKSSRKNSVAQISMTTPTS
FT                   SRAQSNTTSESPPAIPGGAASAAGRTAGATGKSGVVPIAAAPPKATPTSAGQSRSTVQV
FT                   APKRQRRLEKASETDAADDSNKPSTSSGGRSKVVPLAPAMPPAAVNPANHSIAGGQGAS
FT                   QEWEWLTMSL"
     MSGMSHGGAP KAARPTPTAV SASSGYDIAD ADRSSSSHFH HTSQLSDDFS LGSPLSPPDS        60
     AHVQDGLLQD SLFPEWRNAA PRDGVESPDE MQRKDPLATQ IWKLYSRTKA QLPNQERMEN       120
     LTWRMMAMSL KRKERERLQQ NNRPSTKNSG SSEPSGIAQL RQTDRPSFAR PSTSTDLASD       180
     PMNIDDFIVP IESPADRPRS PPTDKAATSS VAIPIKSRKD QSADATPVPA SFPHPPQDQR       240
     RNNEFGYVPR RVRKTSIDER QFFNLQIPTR KRPAESSPQV PPVSNAMLAQ DPNFSAGVPD       300
     YTLDNASSGF ALHSNTQNHH NNNNLTSPGV PFGLDTFSLG EDPILSSAGP YQAHFTFSPS       360
     DSPMTSANPF ANVYAQTPIA SSLNSTEFFS PPPSGYQSSV STPQPTYDGD HSMYFDMPSI       420
     DARTQRRIPN YITHRSNLSA SLQPRFMFNN NTGSEQQHGM THGSNSSSAV HSPNYTMSQS       480
     QHVDPTQVLN PSDFPTSNTH AGIFSFGADS DNEDDDANNY TERAGLAMPA DFGDDNAGDM       540
     NGLNWDGQFP GSFHSLSGFS VQHRKHVTIG SADMMDTPSE WNQGGSLGRT HGSAASVSEV       600
     RNREQDPRRQ KIARTTSTPN TNQLLRQSMN NTSHTSPNTP PESGLSSAVP SRPASPGGSK       660
     NGDQNNGPTT CTNCFTQTTP LWRRNPEGQP LCNACGLFLK LHGVVRPLSL KTDVIKKRNR       720
     SSANSLAVGA SRSSKKSSRK NSVAQISMTT PTSSRAQSNT TSESPPAIPG GAASAAGRTA       780
     GATGKSGVVP IAAAPPKATP TSAGQSRSTV QVAPKRQRRL EKASETDAAD DSNKPSTSSG       840
     GRSKVVPLAP AMPPAAVNPA NHSIAGGQGA SQEWEWLTMS L                           881
//

If you have problems or comments...

PBIL Back to PBIL home page