(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE85

ASFUM1_6.PE85        Location/Qualifiers
FT   CDS             join(complement(307556..308110),complement(307298..307492),
FT                   complement(307057..307260))
FT                   /codon_start=1
FT                   /gene_family="HOG000197115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263229"
FT                   /orf_name="AFUA_6G01980"
FT                   /product="Haemolysin-III family protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85841.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG056368"
FT                   /db_xref="HOGENOM:HBG749828"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniParc:UPI0000520217"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP7"
FT                   /transl_table=1
FT                   /translation="MVFNGLLRFRIIRSKQVKEIALGGGHDQSQPVEKQTLLTIKQLPP
FT                   WYDPNPFILSGYRPETRSYYRCFASWLYCHNETGNIYSHLIPGILLLSSQGILYEYIRT
FT                   KHENLSNFDWSIVSLQLVTASICLLTSTTYHTLLNHSAAVAHRWLQLDYIGIIALILGN
FT                   FISGLHFGFYCNPQLKHFYWSLILAFSSATAVALLSPQFRGLEWRSFRLASFVCTGLSA
FT                   FAPIGHACMLWGVPYLWKIGVKYYLLEGAFVNCIQKGKITDTLQKRVPESLYPGAFDIW
FT                   GHSHTIWHVFVTFSIGAHVMGLLHGLEYSYSQAECR"
     MVFNGLLRFR IIRSKQVKEI ALGGGHDQSQ PVEKQTLLTI KQLPPWYDPN PFILSGYRPE        60
     TRSYYRCFAS WLYCHNETGN IYSHLIPGIL LLSSQGILYE YIRTKHENLS NFDWSIVSLQ       120
     LVTASICLLT STTYHTLLNH SAAVAHRWLQ LDYIGIIALI LGNFISGLHF GFYCNPQLKH       180
     FYWSLILAFS SATAVALLSP QFRGLEWRSF RLASFVCTGL SAFAPIGHAC MLWGVPYLWK       240
     IGVKYYLLEG AFVNCIQKGK ITDTLQKRVP ESLYPGAFDI WGHSHTIWHV FVTFSIGAHV       300
     MGLLHGLEYS YSQAECR                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page