(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE86

ASFUM1_6.PE86        Location/Qualifiers
FT   CDS             join(308940..309108,309165..310081)
FT                   /codon_start=1
FT                   /gene_family="HOG000048652" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263230"
FT                   /gene_name="ipi1"
FT                   /orf_name="AFUA_6G01990"
FT                   /product="Pre-rRNA-processing protein ipi1 "
FT                   /function="binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85840.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG056367"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051F8CB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCP8"
FT                   /transl_table=1
FT                   /translation="MGSSAKKKKEKKKDFQVSHASCLHQSITNSAQKTKLKVGKTKAKP
FT                   DNFTDTSFRAKTITLNQQSLHITAPSSDAQFTHHVSLLSSKSDTQRRDSLAHLTTSLVS
FT                   RPVDSPLPQPVSVLLPTLLPLILDASSSVRTQLLKLLRALPANDIQDHVPQLLPYIRAG
FT                   MTHLAADIRVSAVEVLSWLVDVAGAEVVSCAGGWIKTLNCFLSVLGWHTEESSKWSGNR
FT                   ASFGKSGAKGQPMVKVLAALAVFLQAGIGRPDERMDDSSDEDSAPGVSGWEFPLCHAAQ
FT                   HMVPQATAPFVHLNLFGQPRDEEGEMYETREDRYRVFENRFLGAVQRGLESARGEGGEV
FT                   GRASAGVSKVLKEAIAYGPGV"
     MGSSAKKKKE KKKDFQVSHA SCLHQSITNS AQKTKLKVGK TKAKPDNFTD TSFRAKTITL        60
     NQQSLHITAP SSDAQFTHHV SLLSSKSDTQ RRDSLAHLTT SLVSRPVDSP LPQPVSVLLP       120
     TLLPLILDAS SSVRTQLLKL LRALPANDIQ DHVPQLLPYI RAGMTHLAAD IRVSAVEVLS       180
     WLVDVAGAEV VSCAGGWIKT LNCFLSVLGW HTEESSKWSG NRASFGKSGA KGQPMVKVLA       240
     ALAVFLQAGI GRPDERMDDS SDEDSAPGVS GWEFPLCHAA QHMVPQATAP FVHLNLFGQP       300
     RDEEGEMYET REDRYRVFEN RFLGAVQRGL ESARGEGGEV GRASAGVSKV LKEAIAYGPG       360
     V                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page