(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE9

ASFUM1_6.PE9         Location/Qualifiers
FT   CDS             join(complement(63892..63951),complement(63549..63743),
FT                   complement(63453..63464))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262206"
FT                   /orf_name="AFUA_6G00196"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84246.1"
FT                   /db_xref="HOGENOM:HBG056505"
FT                   /db_xref="UniParc:UPI000051F9AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X3"
FT                   /transl_table=1
FT                   /translation="MLGLAVCPFLPSFQLKRLCCCLFHQTIVPTAPQILQDFHSRDRIH
FT                   QTLLVTIWELGEGIGPFFIAPLSERFGRLPVLHLGKGGGWTFY"
     MLGLAVCPFL PSFQLKRLCC CLFHQTIVPT APQILQDFHS RDRIHQTLLV TIWELGEGIG        60
     PFFIAPLSER FGRLPVLHLG KGGGWTFY                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page