(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE91

ASFUM1_6.PE91        Location/Qualifiers
FT   CDS             join(complement(326592..326609),complement(325918..326523))
FT                   /codon_start=1
FT                   /gene_family="HOG000202555" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207409"
FT                   /orf_name="AFUA_6G02040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85835.1"
FT                   /db_xref="HOGENOM:HBG056364"
FT                   /db_xref="HOGENOM:HBG327040"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniParc:UPI0000520216"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ3"
FT                   /transl_table=1
FT                   /translation="MAYATVTTQVPQHVTALLSHLTSRPGVQSTFILSRKDGSIIQSTG
FT                   LLASPPPRNSTTSETQTPPAPNDANSTTTIPTESLDPSSPAGASTARAPTAQKPYQPSQ
FT                   AEALAARIFAFVESASELGMTLSCPRAEDMDSYQTGLNGDGAGRDDARSEGVDREEEDE
FT                   VKLLRLRTKKHEIVVVPDRKYLLCVVHDAAHASGGSGVAGVRSR"
     MAYATVTTQV PQHVTALLSH LTSRPGVQST FILSRKDGSI IQSTGLLASP PPRNSTTSET        60
     QTPPAPNDAN STTTIPTESL DPSSPAGAST ARAPTAQKPY QPSQAEALAA RIFAFVESAS       120
     ELGMTLSCPR AEDMDSYQTG LNGDGAGRDD ARSEGVDREE EDEVKLLRLR TKKHEIVVVP       180
     DRKYLLCVVH DAAHASGGSG VAGVRSR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page