(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE92

ASFUM1_6.PE92        Location/Qualifiers
FT   CDS             join(complement(329353..330141),complement(328016..329282),
FT                   complement(327827..327977),complement(327351..327795))
FT                   /codon_start=1
FT                   /gene_family="HOG000202544" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263234"
FT                   /orf_name="AFUA_6G02050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85834.1"
FT                   /db_xref="HOGENOM:HBG056363"
FT                   /db_xref="UniParc:UPI000051FFE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ4"
FT                   /transl_table=1
FT                   /translation="MSTLPSQTQYLAAAENDRPRQSLEVQMTNEDITELHRFLQSPSTT
FT                   PASQVTGARELLKAGQRRLRQLAQLQWKPTDPKTKAEEASRHLLVLQQEGFLSLPASAA
FT                   KKSLDSVMSGSRSASSFGFRSSSQRDVEKIGQPWLENPLEVSATQHIKSPEPSPLDLGN
FT                   LTSMVEAAVSFPFHFDDAYPPPYQPPANTTSDQRTEGQDSCHLHSAACQLKPKERRTED
FT                   QGAPSAVSTRQVLTNGKDHIPPTVLPIKDVARDGPKDGKSQVVDSDEDQNNSAQLLKPP
FT                   TSRAKAGPRDPPNPVAQSLKLFPDTMPPRSSSKGAWRIPNNRIRGKNAPISAKFSDSQQ
FT                   IPATVASKRETDNVKNSIKGTSECQGDPQRSYHSGKASTTRPRKPCSEPAMSPIHPEFP
FT                   RLKNTRRPASLPMGTIDSFPLPAPLRPLPSLPEQPPALSTVRHHNTPVIKAATRTNRDH
FT                   SGAFPTTTSNNRSDAEHCHLNTQFALPQLSLVGDDLPASEQGKSVEEAPPNHPESSGKA
FT                   EENQAERLHSLKFRDMMASRISLDEARKGDGINSPASPMSSGSDHELRIGYENEHLVRT
FT                   SVQKEATPPAPLSPPLSPPPAPPLVKSAEQLPFSRRHVSSATAIMRASTERREPSLPAS
FT                   DRSATVHRSKRTRSIDVLHELVASEQHTSNRAGSPLPSSDDECMDKGTFMCSLKKVEQS
FT                   LSEPTAWSKEVQYPRSERPLDAAKAKKPHFGGDTLIIARLIERDKAAHTLVLLEGRIEQ
FT                   LERQNRILQAALFAALDLGVKPNAEALLGGSTTSLSASANSSSAETSSPSSTQRASKLP
FT                   GRAVANGRRSLMKKSLRRPESWIDSPGASLQSDYQSDDDVSVRDLEEMIEDIEFTCSSD
FT                   KPGSDRVRIGRD"
     MSTLPSQTQY LAAAENDRPR QSLEVQMTNE DITELHRFLQ SPSTTPASQV TGARELLKAG        60
     QRRLRQLAQL QWKPTDPKTK AEEASRHLLV LQQEGFLSLP ASAAKKSLDS VMSGSRSASS       120
     FGFRSSSQRD VEKIGQPWLE NPLEVSATQH IKSPEPSPLD LGNLTSMVEA AVSFPFHFDD       180
     AYPPPYQPPA NTTSDQRTEG QDSCHLHSAA CQLKPKERRT EDQGAPSAVS TRQVLTNGKD       240
     HIPPTVLPIK DVARDGPKDG KSQVVDSDED QNNSAQLLKP PTSRAKAGPR DPPNPVAQSL       300
     KLFPDTMPPR SSSKGAWRIP NNRIRGKNAP ISAKFSDSQQ IPATVASKRE TDNVKNSIKG       360
     TSECQGDPQR SYHSGKASTT RPRKPCSEPA MSPIHPEFPR LKNTRRPASL PMGTIDSFPL       420
     PAPLRPLPSL PEQPPALSTV RHHNTPVIKA ATRTNRDHSG AFPTTTSNNR SDAEHCHLNT       480
     QFALPQLSLV GDDLPASEQG KSVEEAPPNH PESSGKAEEN QAERLHSLKF RDMMASRISL       540
     DEARKGDGIN SPASPMSSGS DHELRIGYEN EHLVRTSVQK EATPPAPLSP PLSPPPAPPL       600
     VKSAEQLPFS RRHVSSATAI MRASTERREP SLPASDRSAT VHRSKRTRSI DVLHELVASE       660
     QHTSNRAGSP LPSSDDECMD KGTFMCSLKK VEQSLSEPTA WSKEVQYPRS ERPLDAAKAK       720
     KPHFGGDTLI IARLIERDKA AHTLVLLEGR IEQLERQNRI LQAALFAALD LGVKPNAEAL       780
     LGGSTTSLSA SANSSSAETS SPSSTQRASK LPGRAVANGR RSLMKKSLRR PESWIDSPGA       840
     SLQSDYQSDD DVSVRDLEEM IEDIEFTCSS DKPGSDRVRI GRD                         883
//

If you have problems or comments...

PBIL Back to PBIL home page