(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE94

ASFUM1_6.PE94        Location/Qualifiers
FT   CDS             join(complement(345509..345961),complement(342486..345437),
FT                   complement(342202..342431),complement(341260..342151))
FT                   /codon_start=1
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263235"
FT                   /orf_name="AFUA_6G02070"
FT                   /product="Phospholipid-translocating P-type ATPase domain-
FT                   containing protein"
FT                   /EC_number="3.6.3.1"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85832.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG176466"
FT                   /db_xref="HOGENOM:HBG745019"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000520215"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ6"
FT                   /transl_table=1
FT                   /translation="MASDFLSPDSIDPGNGVREVSSNVSKPTKRQRWATQRVAGAGGVR
FT                   KRVSIMDRLHKRSEAKSEKRGSMLPPTDDSNTESDQDAQGGSNRRVYFNIPIPESERDE
FT                   DGQIKTSYPRNKIRTAKYTPLTFIPKNIWFQFHNIANIYFLFIIILGFFSIFGVDNPAL
FT                   NTVPLIVIVVATAIKDAIEDWRRTVLDNELNNSPVYRLVEWNNVNSTEDKVSLWRRFKK
FT                   ACTRATISTYRWIRRLMKKNKDVPQMFQDERRASILTTVTPRASVYSQRGDHGMEEDAI
FT                   QMTPVPSPSAEARADWPLPAGDSDQFLHPDKRNRDSLQAVTLPVTPPRKGGSVVDPSKQ
FT                   TIGKARFKRDYWKNIQVGDFVRLYNGDPIPADIVVLSTSDPDGACYVETKNLDGETNLK
FT                   VRQALNCGRQVRHARDCEKAEFLIDSEAPHPNLYAYNGALRWEQRDPDYPDAPRREMVE
FT                   PITISNMLLRGCSLRNTEWALGVVIFTGDETKVMLNSGVTPSKRAKLAKALNWNVIYNF
FT                   ILLFAMCFVSAVVNGVAWGSDDRSLNYFDFGSYGSTPVVTAIITFWVALILFQNLVPIS
FT                   LYISLEIVRTCQAIFIHSDVFMYYEKLGISCVPKSWNISDDVGQIEYIFSDKTGTLTQN
FT                   VMDFKKCTINGVSYGEAFTEAQVGMIRREGGDADTVAAEAREKIAADTTKMLQMLRRIH
FT                   DNPYLRDENLTFIAPDYVADLEGQSGEAQKQATEHFMLALALCHTVITEQTPGDPPQIE
FT                   FKAQSPDEAALVSTARDCGFTLLGRSGDDLILNVMGEERTYTVLNTLEFNSTRKRMSAI
FT                   IRMPDGTIRLFCKGADSIIYSRLARGKQQELRKKTAEHLEEFAREGLRTLCVAERVLSE
FT                   EEYRTWSKEHDIAAAALTDREQKLEQVSSEIEQELMLIGGTAIEDKLQDGVPDTISLLA
FT                   DAGIKLWVLTGDKVETAINIGFSCNLLTNDMELLVFNIPEDQPQRASQELDEQLQKFGL
FT                   TGSDEELIAAREDHRPPPATHAVVIDGDTLKLMLSDELKQRFLLLCKQCKSVLCCRVSP
FT                   AQKAAVVRLVKNGLNIMALSIGDGANDVAMIQEADVGVGIVGEEGRQAAMSSDYAIGQF
FT                   RFLQRLILVHGRWSYRRMGETIANFFYKNMVWTIALFWYSLYNDFDGSYLFDYTYIVLV
FT                   NVAFTSLPVILMGIFDQDVDDKVSLAVPQLYMRGIERKEWSQTKFWLYMLDGFYQSIIC
FT                   FYMPYLLFSPATFVHSNGLNINDRTRMGVLVASCAVIASNTYILMNTYRWDWLTVLINV
FT                   ISSLLIFFWTGIYSSTTASAQFYKAAAEVYGALSFWVVLLMTVIICLLPRFTVKAVQKV
FT                   FFPRDVDIIREQVTQGKFKYLDQYEAFVPPKAAATSGGLSNGSAASSDLGKPIQSSMKQ
FT                   DPFSDDQQIYPPSVAPTIHTHNPRSQNGSNGTNYSFDTTQHPRPQSVQSAQRTRHSFDR
FT                   ARPSYDVNSDFNSGAMLSRVDSATGIPVPQSPHSPLKSPHDPPSYQV"
     MASDFLSPDS IDPGNGVREV SSNVSKPTKR QRWATQRVAG AGGVRKRVSI MDRLHKRSEA        60
     KSEKRGSMLP PTDDSNTESD QDAQGGSNRR VYFNIPIPES ERDEDGQIKT SYPRNKIRTA       120
     KYTPLTFIPK NIWFQFHNIA NIYFLFIIIL GFFSIFGVDN PALNTVPLIV IVVATAIKDA       180
     IEDWRRTVLD NELNNSPVYR LVEWNNVNST EDKVSLWRRF KKACTRATIS TYRWIRRLMK       240
     KNKDVPQMFQ DERRASILTT VTPRASVYSQ RGDHGMEEDA IQMTPVPSPS AEARADWPLP       300
     AGDSDQFLHP DKRNRDSLQA VTLPVTPPRK GGSVVDPSKQ TIGKARFKRD YWKNIQVGDF       360
     VRLYNGDPIP ADIVVLSTSD PDGACYVETK NLDGETNLKV RQALNCGRQV RHARDCEKAE       420
     FLIDSEAPHP NLYAYNGALR WEQRDPDYPD APRREMVEPI TISNMLLRGC SLRNTEWALG       480
     VVIFTGDETK VMLNSGVTPS KRAKLAKALN WNVIYNFILL FAMCFVSAVV NGVAWGSDDR       540
     SLNYFDFGSY GSTPVVTAII TFWVALILFQ NLVPISLYIS LEIVRTCQAI FIHSDVFMYY       600
     EKLGISCVPK SWNISDDVGQ IEYIFSDKTG TLTQNVMDFK KCTINGVSYG EAFTEAQVGM       660
     IRREGGDADT VAAEAREKIA ADTTKMLQML RRIHDNPYLR DENLTFIAPD YVADLEGQSG       720
     EAQKQATEHF MLALALCHTV ITEQTPGDPP QIEFKAQSPD EAALVSTARD CGFTLLGRSG       780
     DDLILNVMGE ERTYTVLNTL EFNSTRKRMS AIIRMPDGTI RLFCKGADSI IYSRLARGKQ       840
     QELRKKTAEH LEEFAREGLR TLCVAERVLS EEEYRTWSKE HDIAAAALTD REQKLEQVSS       900
     EIEQELMLIG GTAIEDKLQD GVPDTISLLA DAGIKLWVLT GDKVETAINI GFSCNLLTND       960
     MELLVFNIPE DQPQRASQEL DEQLQKFGLT GSDEELIAAR EDHRPPPATH AVVIDGDTLK      1020
     LMLSDELKQR FLLLCKQCKS VLCCRVSPAQ KAAVVRLVKN GLNIMALSIG DGANDVAMIQ      1080
     EADVGVGIVG EEGRQAAMSS DYAIGQFRFL QRLILVHGRW SYRRMGETIA NFFYKNMVWT      1140
     IALFWYSLYN DFDGSYLFDY TYIVLVNVAF TSLPVILMGI FDQDVDDKVS LAVPQLYMRG      1200
     IERKEWSQTK FWLYMLDGFY QSIICFYMPY LLFSPATFVH SNGLNINDRT RMGVLVASCA      1260
     VIASNTYILM NTYRWDWLTV LINVISSLLI FFWTGIYSST TASAQFYKAA AEVYGALSFW      1320
     VVLLMTVIIC LLPRFTVKAV QKVFFPRDVD IIREQVTQGK FKYLDQYEAF VPPKAAATSG      1380
     GLSNGSAASS DLGKPIQSSM KQDPFSDDQQ IYPPSVAPTI HTHNPRSQNG SNGTNYSFDT      1440
     TQHPRPQSVQ SAQRTRHSFD RARPSYDVNS DFNSGAMLSR VDSATGIPVP QSPHSPLKSP      1500
     HDPPSYQV                                                               1508
//

If you have problems or comments...

PBIL Back to PBIL home page