(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE96

ASFUM1_6.PE96        Location/Qualifiers
FT   CDS             join(complement(353062..353609),complement(352850..353000))
FT                   /codon_start=1
FT                   /gene_family="HOG000202506" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207410"
FT                   /orf_name="AFUA_6G02090"
FT                   /product="ATP synthase subunit E, putative "
FT                   /EC_number="3.6.3.14"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, catalytic domain"
FT                   /protein_id="EAL85830.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0033178"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG285939"
FT                   /db_xref="HOGENOM:HBG525538"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniParc:UPI000051F19D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ8"
FT                   /transl_table=1
FT                   /translation="MQVHRAHPVYEQVAGELRKMTAFIRQEALEKAREIQLKADEEFAI
FT                   EKSKLVRQETAAIDSLYEKKFKQAAMSQQITRSTLANRTRLRVLSARQELLNDLFQQAR
FT                   EKISTVASQDAKKYQNVLKGLILEGLYALNEDKVSVRARKTDFSVVKNAIEEALKEFKS
FT                   TVGKEATAELDEADPLPEGSAGGVYIVGGQGKIEINNTFEERLRLLEVDALPAVRETLF
FT                   GKNANRKFYD"
     MQVHRAHPVY EQVAGELRKM TAFIRQEALE KAREIQLKAD EEFAIEKSKL VRQETAAIDS        60
     LYEKKFKQAA MSQQITRSTL ANRTRLRVLS ARQELLNDLF QQAREKISTV ASQDAKKYQN       120
     VLKGLILEGL YALNEDKVSV RARKTDFSVV KNAIEEALKE FKSTVGKEAT AELDEADPLP       180
     EGSAGGVYIV GGQGKIEINN TFEERLRLLE VDALPAVRET LFGKNANRKF YD               232
//

If you have problems or comments...

PBIL Back to PBIL home page